KEGG   Asticcacaulis excentricus: Astex_0990Help
Entry
Astex_0990        CDS       T01378                                 

Definition
(GenBank) Glutaminase, core
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
aex  Asticcacaulis excentricus
Pathway
aex00220  Arginine biosynthesis
aex00250  Alanine, aspartate and glutamate metabolism
aex00471  D-Glutamine and D-glutamate metabolism
aex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Astex_0990
   00220 Arginine biosynthesis
    Astex_0990
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Astex_0990
Enzymes [BR:aex01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Astex_0990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ADU12671
UniProt: E8RLQ4
Position
1:1036283..1037206
Genome map
AA seq 307 aa AA seqDB search
MKHELSLPEVLSQIEKTVRPQFGKGRVADYIPELATVDPKKFGMAVRTVSGQEYVIGDGD
EPFSAQSVTKLFALGIALNRIGDEVWTRVGKEPSGTPFNYLSQLEHEAGFPRNPFINAGA
LAVVDMLLKGTRRPDLTVRDYMGFLCQNALTIDEAVARSEIETAHKNRAIANLMKGAGTL
HHEVETVIAAYCRQCAITLSCRDLARAALPLAAGGYSPVIEETVFPARQARRLNALLLTC
GVYDSVGSFAYRVGLPAKSGVGGGIVAIVPGQAAIAVWSPELDRHGTSVVGFAALEAFSQ
ITNCSVL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacgaactgtccctgcccgaagtcctgtcgcagatcgaaaagacggtgaggccg
caattcggcaagggccgggtggccgactatatcccggaactggcaaccgtcgatccgaag
aagttcggcatggcggtacgcacagtctcgggacaggagtacgtcatcggtgatggcgac
gaacccttttcggcgcagtcggtcaccaagctgtttgcgctggggatcgcgctcaaccgc
attggcgatgaggtgtggacgcgggtgggtaaggagccgtcgggcacgcccttcaactac
ctgtcgcagcttgagcatgaggccgggtttccgcgtaatccgtttatcaacgccggggcg
ctggcggtggtcgatatgctgctcaaaggcacgcggcggccggacctgacggtgcgcgac
tatatggggttcctctgtcagaacgccctgaccatagatgaggccgtggcgcgttcggaa
attgaaacggcccataagaaccgcgccattgccaacctgatgaagggggccggcacactg
catcatgaggtagaaaccgtcatcgcggcctattgccgccaatgcgccattaccctgtcg
tgtcgggatctggcgcgcgccgccctgccactggcggccggtgggtattcgcccgtaatc
gaagagacggtgttccccgcgcggcaggcgcggcggctcaatgccctgctgctgacctgc
ggcgtgtacgattcggtggggtcgtttgcctatcgcgtcggcctgccggccaaaagcggc
gtcggcggcggcatcgtcgccattgtgccgggacaggccgctattgccgtgtggtcaccg
gaactggatcgccacgggacgtctgtggtgggttttgcggcgctggaggccttcagccag
atcaccaactgttcggtcctgtga

DBGET integrated database retrieval system