KEGG   Asticcacaulis excentricus: Astex_1766Help
Entry
Astex_1766        CDS       T01378                                 

Definition
(GenBank) pseudouridine synthase, RluA family
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
aex  Asticcacaulis excentricus
Brite
KEGG Orthology (KO) [BR:aex00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:aex03009]
    Astex_1766
Enzymes [BR:aex01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     Astex_1766
Ribosome biogenesis [BR:aex03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Astex_1766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: ADU13432
UniProt: E8RRI7
Position
1:1903123..1904127
Genome map
AA seq 334 aa AA seqDB search
MTPDDDIDDDLPLASNGETHDLVLTSDMAGDRLDRALLPLLPDLSRARLQALISDGHLSH
DGQTIADGKHKARAGLYRLFVPAPVSAIPEAQNLPLEVLYEDAHLIVVNKPAGMAAHPAP
GTADGTLVNALLFHCGESLSGIGGVLRPGIVHRLDKDTSGVMVAAKSDAAHRGLSELFSR
HDIDRAYEALVRGAPKTASGTVTTRIGRSPHDRKKMAVLKSGGREAISHYRTLNSFGGEK
PVAARVRCTLETGRTHQIRVHMAYLGCPCLGDPVYGSGAPHRAVAEALKTLSFARQALHA
AHLGFVHPVTGERLAFEAPLPADMADLLSALKLL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacccctgacgacgacatagatgacgatctgccgctggccagcaatggcgagacgcac
gaccttgtgctgacctcggacatggccggagacaggctagaccgcgcgctgttgccgctg
ctgcccgacctgtcgcgcgcccgtcttcaggccctgatcagcgacgggcatctgagccac
gacggacagacaatcgccgatggcaagcataaggccagggccgggctctaccgcctgttc
gtccctgcccccgtctcggcgattcccgaagcacagaacttgccgctggaggtgctgtat
gaggacgcccacctgatagtggtcaacaagccagccggcatggccgcccacccggccccc
ggcacggcggatgggactctggtcaatgccctactgtttcactgcggcgaatcgctgtcg
ggtatcggcggcgtcctgcgccccggcattgtccatcgtctcgacaaggacacctccggc
gtcatggtggcggccaagtccgacgccgcccatcgcggcttaagcgagttgttttctcgc
cacgatatcgaccgcgcctatgaggcattggtgcgcggcgcaccgaaaaccgcctcaggc
acggtcaccacgcgtatcggccgctcaccccacgaccgcaaaaagatggccgttcttaaa
agcggcgggcgcgaagccatctcccactaccgcacattgaacagcttcggcggtgagaaa
cccgtcgcggcccgcgtgcgctgcacgctggaaaccggacgcacccatcaaattcgcgtg
cacatggcctatctaggctgtccgtgtctgggagatccggtctatggttccggtgcgccg
cacagggcggtcgccgaagcgctgaaaaccctgtccttcgcgcgtcaagccctgcacgcc
gcgcatctgggcttcgtccatcctgtcacgggcgagcgtctcgcctttgaagcccccctg
ccggcggatatggcagaccttctgagcgctttgaaattgctttaa

DBGET integrated database retrieval system