KEGG   Asticcacaulis excentricus: Astex_1792Help
Entry
Astex_1792        CDS       T01378                                 

Definition
(GenBank) aminotransferase class-III
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
aex  Asticcacaulis excentricus
Pathway
aex00860  Porphyrin and chlorophyll metabolism
aex01100  Metabolic pathways
aex01110  Biosynthesis of secondary metabolites
aex01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aex00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Astex_1792
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aex01007]
    Astex_1792
Enzymes [BR:aex01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     Astex_1792
Amino acid related enzymes [BR:aex01007]
 Aminotransferase (transaminase)
  Class III
   Astex_1792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADU13456
UniProt: E8RRL1
Position
1:complement(1924915..1926270)
Genome map
AA seq 451 aa AA seqDB search
MTALSDFFTEQKRLFTATHPKTVALAEQAKSVWRGGVPMHWMHDWASPVPLYAERAKDAT
LWDVDGHAYDDFCLGDTPSMFGHGREELQRAIAAQAGQGVGFMLPTRSSLEVGRLLKDRF
GLPVWQCATTASDANRAVIRWARAITQRQKILFIDGAYHGMVDDAFVVLKDGQIVHKTGL
IGQVADLTQHSVVVPFNDLTALESVLRTGEIAAVMLEPVMTNCGMILPIEGYHERLRALC
DETGTLLVYDETHTLSSGFGGYVSEHGLRADVLTVGKAIAGGVPAAVWGVSAEVAARMDA
AQAAIGPGSSGIGTTLSGNALAIAGMKAMLSEVMTPDAYAYMQASAETLVAKLRAVIAQH
QVPWSVVHVGARAELVFADPAPQTAAEMRHALDPHLLEALHLYLINRGVLIAPFHNMMLI
SPKTPPEAIDRLVAAVEGFITEYTRFTSSAA
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgacggctctgtctgattttttcacagaacaaaagcgcctgttcaccgccactcacccc
aaaaccgttgctctggccgaacaggctaaaagtgtgtggcgaggcggggtgccgatgcac
tggatgcacgactgggcctcgcccgtgccgctctatgccgagcgggcaaaggatgcgacc
ctgtgggacgtcgatggccacgcctatgacgacttctgtctgggcgataccccctcaatg
ttcggccatgggcgcgaggagctgcaacgcgccattgccgcacaggcggggcagggggtg
ggcttcatgctgccgacccgctccagccttgaggtggggcggctgctgaaagaccggttc
ggcctgccggtatggcagtgcgcgacgacggcgtctgacgccaatcgcgccgtcatccgc
tgggcgcgggccattacgcagcggcagaagatcctgtttatcgacggggcctatcatggc
atggtcgatgacgcttttgtggtgctgaaggacgggcagatcgtccacaaaaccggcctg
atcgggcaggtcgccgacctgacgcagcatagcgtcgtcgtgccgttcaacgacctgacg
gcgctggagtcggtgctgcgcacgggtgagatcgccgccgtcatgctggaacccgtcatg
accaattgtggcatgatcctaccgattgagggctatcacgagcgcctgcgcgccctgtgt
gacgagacgggcacgctgctggtttacgatgagacgcacaccctgtcgtcggggtttggc
ggctatgtgagtgagcatggtctgcgcgccgacgtcctgaccgtgggtaaggccattgcc
ggaggggtgcccgccgccgtctggggcgtcagcgccgaagtcgccgcgcgcatggacgcc
gctcaggccgccatcggaccgggctcgtccggcattggcaccaccttgtccggcaatgcg
ctggccattgccggcatgaaggccatgctcagcgaggtcatgaccccggacgcctatgcc
tacatgcaagccagcgccgaaacccttgtggccaaactgagggccgtcatcgcgcagcat
caggtgccttggtcggtggtgcatgtcggcgcgcgggccgagctggtctttgccgatccg
gccccgcaaaccgccgccgaaatgcgccacgcgctggacccgcacctgctggaggccctg
catctctatctgatcaatcgcggggtgctgatcgcgcccttccacaatatgatgctgatt
tcgcccaaaaccccaccggaggccattgaccgtctcgtggcggcggtggaaggttttatc
actgagtacacgcgtttcacgtcctccgctgcataa

DBGET integrated database retrieval system