KEGG   Asticcacaulis excentricus: Astex_3426Help
Entry
Astex_3426        CDS       T01378                                 

Definition
(GenBank) 3-oxoacid CoA-transferase, A subunit
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
aex  Asticcacaulis excentricus
Pathway
aex00072  Synthesis and degradation of ketone bodies
aex00280  Valine, leucine and isoleucine degradation
aex00650  Butanoate metabolism
aex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Astex_3426
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Astex_3426
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Astex_3426
Enzymes [BR:aex01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     Astex_3426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: ADU15058
UniProt: E8RQ86
Position
2:complement(1207393..1208100)
Genome map
AA seq 235 aa AA seqDB search
MPSKIYSDAKSALEGLTFDGMTVMAGGFGLCGIPENLIGALRDTGVTGITAISNNAGVDG
FGLGMLLNTRQIKKMISSYVGENKEFERQYLAGELELEFNPQGTLAERIRAGGAGIPGFY
TATGVGTLVAEGKELKEFNGKTFVLETGLVADLSIVKAWKADERGNLIFRKTARNFNPMM
ATAGKVCVAEVEEIVPVGSLDPDCIHTPGIYVDRLIKGTFEKRIEQRTVRQRQGA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgaagatatattcggacgcgaagagtgcgctggaggggctgacgtttgacggg
atgacggtgatggccgggggctttggcctttgcggtatcccggagaacctgatcggagcc
ctgcgcgacacgggcgtgaccgggatcaccgccatttccaacaatgccggggtcgatggc
ttcgggctggggatgctgctcaatacgcgtcagatcaaaaagatgatctcgtcctatgtc
ggcgaaaacaaggagttcgagcggcagtacctggcgggcgagctggagctggagttcaat
ccgcagggcaccctggcggaacggattcgggccggcggagccgggattccgggcttctat
accgccaccggcgttggcacgctggttgccgaaggcaaggagctgaaagagttcaacggg
aagacctttgttcttgagacgggattggtcgccgacctctccatcgtcaaggcgtggaaa
gccgatgaacgcggcaatctgattttccgcaagacggcgcgcaatttcaacccgatgatg
gccaccgccggcaaggtctgcgtcgccgaggtcgaggagatcgtgccggtggggtcgctc
gatcccgactgcatccatacgccaggcatatatgtcgatcgcctgatcaaaggcacgttt
gaaaagcggatcgaacagcgcaccgtgcgtcagagacaaggagcctga

DBGET integrated database retrieval system