KEGG   Asticcacaulis excentricus: Astex_3427Help
Entry
Astex_3427        CDS       T01378                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
aex  Asticcacaulis excentricus
Pathway
aex00072  Synthesis and degradation of ketone bodies
aex00650  Butanoate metabolism
aex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Astex_3427
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Astex_3427
Enzymes [BR:aex01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Astex_3427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Motif
Other DBs
NCBI-ProteinID: ADU15059
UniProt: E8RU88
Position
2:1208280..1209071
Genome map
AA seq 263 aa AA seqDB search
MTDGSLRGRTALISGSVQGIGLAIAEAFARAGANIALHGLATPQQVDAATDHIRRLGAQV
RFFEGDLRDRTAIDGLMAAVWDWGGGIDIVINNAGVQKTLPFAQIDDATWDMVLSVNLTA
AMATMRYALPRMAARGFGRVINIASVHGLVASVEKGPYVASKFGLVGLSKVAALEYACSG
VTINCLCPGWTETALIEPQIQARAAAEGGDRQAGIAALLAEKQPSQRMSAPEEIAALALW
LSSPLAHNVTGTAIPIDGGWTAQ
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgggtctcttcgcgggcggaccgcgctgatcagcggctccgttcagggcatc
gggctggccatagccgaagcctttgccagagccggggccaatatcgccctgcatgggctg
gccacgccgcagcaagtcgatgccgccaccgatcatatccgccgtctgggggcgcaggtg
cgctttttcgaaggggatctgcgcgaccggacggccattgacggcctgatggcggcggtg
tgggattggggcggcggcatcgacatagtgatcaacaatgccggggtgcagaagaccctg
ccctttgctcagatagatgatgcgacctgggatatggtgttgtcggtcaatctgacggcg
gccatggcaaccatgcgctatgccttgccgcgcatggcggcgcgcggcttcgggcgcgtc
atcaatatcgcttcggtgcacggccttgtggcctcggtggagaaggggccctatgtggct
tcgaaattcggactcgtcggcctgtccaaggtggcggctctcgaatatgcgtgcagcggc
gtgaccattaattgcctgtgccccggctggaccgagacggccctgatcgaaccgcagata
caggcgcgcgctgcggctgaagggggtgatcgtcaggcagggattgccgcgcttctggct
gaaaaacagccctcgcaacgcatgagcgccccggaagaaatcgcggcgctggccctgtgg
ctgtcctcgcctctggcccacaatgtgacaggcacggccatccccatcgacgggggatgg
accgcgcaatag

DBGET integrated database retrieval system