KEGG   Actinopolyspora erythraea: CDG81_07335Help
Entry
CDG81_07335       CDS       T05020                                 

Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
aey  Actinopolyspora erythraea
Pathway
aey00860  Porphyrin and chlorophyll metabolism
aey01100  Metabolic pathways
Module
aey_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:aey00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CDG81_07335
Enzymes [BR:aey01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     CDG81_07335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 SNO GATase MobB DJ-1_PfpI Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: ASU78148
UniProt: A0A223RQK7
Position
1615859..1617382
Genome map
AA seq 507 aa AA seqDB search
MNSLLVAGTTSDAGKSVLAAALCRWLARRGARVAPFKAQNMSNNSVVTASGGEIGRAQAV
QAMAAGVEPDVRFNPVLLKPGSDRSSQVVVLGHVAGQATALSYRERKAELLRTVTGTLSE
LRSEYDYVICEGAGSPAEINLRAHDIANMGLARAADLPVLVVGDIDRGGVFAQLFGTLAL
LDPADQALVSGFVINKFRGEPELLTPGLADLRKLTGRQVHGVLPWSEELWLDAEDSLSYV
ADGVVGRPAPPVGEQWLRVAVPRLPRISNATDVEALAAEPGVSVRFVTEPSRVADADLVV
LPGSKSTVADLGWLRETGLARAVLEHAASGAPVLGICGGFQMLGERIVDHVESGAEVEGL
GLLDMDVEFDTTKTLGNPVGTALGRPVAGYEIHHGRVRRPPEAEPLVLLPDGAGEGALHG
SVAGTHWHGLFENDEFRRDFLGRVAGLAGRTGFRGSRDTSFAELRRTQLELLGDMVEHNL
DTDALLRLLNHGAPSGLPGVAVGAVSP
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
gtgaactcactgctggttgccgggaccacctccgacgcgggcaagagcgttctggccgcc
gccctgtgccggtggctggcgcgccgcggggcccgggtggcgccgttcaaagcccagaac
atgtccaacaactccgtggtcacggcctccggcggtgagatcgggcgcgcgcaggccgtg
caggccatggccgcgggggtcgagcccgacgtgcggttcaacccggtgctgctgaagccg
ggaagcgatcgcagttcgcaggtggtggtgctgggccacgtggcggggcaggccaccgcg
ctgtcgtaccgcgagcgcaaggccgagctgcttcgtacggtcaccgggacgctttccgaa
ctgcgctccgagtacgactacgtgatctgcgagggagcgggctcgcccgccgagatcaac
ctgcgcgcccacgacatcgccaacatggggctcgcccgcgcggcggacctgcccgtgctg
gtggttggcgacatagaccggggcggggtgttcgcgcagctgttcggcacgctcgcgctg
ctggaccccgccgaccaggcgctggtttccgggttcgtgatcaacaagttccgaggcgag
cccgagctgctgacccccggtctggcggacctccggaagctcaccggccggcaggtgcac
ggtgtgctcccgtggtcggaggagctgtggctcgacgcggaggactcgctgtcgtacgtg
gccgacggggtggtcggccggcccgctccgccggtgggcgagcagtggctgcgcgtggcc
gtgccccggctgccacgcatctccaacgccaccgacgtcgaggcgctggcggcggagccg
ggggtctcggtgcggttcgtgaccgagccctcccgggtggcggacgcggatctggtggtg
ctccccggctccaagtccacggtcgccgatctcggttggctccgggagaccggtctggcg
cgagccgtgctcgaacacgccgcgtccggtgcgccggtgttggggatctgcggtggtttc
cagatgctgggtgagcggatcgtcgaccacgtcgagtcaggggccgaggtcgaagggctg
ggcctgctggacatggacgtcgagttcgacacgaccaagacgctgggcaatcccgtgggg
acagctctggggcgtcccgtcgccggttacgagatccaccacggcagggtgcgacgccca
ccggaggcggagccgttggtactgctccccgacggggctggtgagggggcgctccacggc
tccgtcgcgggaacgcactggcacgggctgttcgagaacgacgagttccggcgcgatttc
ctcgggcgagtggcgggactggccggcaggaccgggttcaggggatcgcgggacacctcg
ttcgccgagctgcgccgcacccagctggagctgctcggcgacatggtggagcacaacctg
gacaccgacgcgctgctccgactgttgaaccacggcgctccgtccggtctgccgggggtc
gccgtgggtgcggtttccccctga

DBGET integrated database retrieval system