KEGG   Actinopolyspora erythraea: CDG81_13170Help
Entry
CDG81_13170       CDS       T05020                                 

Definition
(GenBank) hypothetical protein
  KO
K10817  6-deoxyerythronolide-B synthase [EC:2.3.1.94]
Organism
aey  Actinopolyspora erythraea
Pathway
aey00522  Biosynthesis of 12-, 14- and 16-membered macrolides
aey01052  Type I polyketide structures
aey01100  Metabolic pathways
aey01110  Biosynthesis of secondary metabolites
aey01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aey00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01052 Type I polyketide structures
    CDG81_13170
   00522 Biosynthesis of 12-, 14- and 16-membered macrolides
    CDG81_13170
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aey01004]
    CDG81_13170
   01008 Polyketide biosynthesis proteins [BR:aey01008]
    CDG81_13170
Enzymes [BR:aey01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.94  6-deoxyerythronolide-B synthase
     CDG81_13170
Lipid biosynthesis proteins [BR:aey01004]
 Polyketide synthase
  Modular PKS
   CDG81_13170
Polyketide biosynthesis proteins [BR:aey01008]
 Polyketide synthase (PKS)
  Modular type I PKS
   cis-AT PKS
    Erythronolide synthase
     CDG81_13170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_1 ketoacyl-synt KR Ketoacyl-synt_C Thioesterase adh_short KAsynt_C_assoc PP-binding adh_short_C2 Epimerase Thiolase_N Polysacc_synt_2 GDP_Man_Dehyd 3Beta_HSD Abhydrolase_6 SAT Sacchrp_dh_NADP NmrA RmlD_sub_bind Docking Abhydrolase_3 DUF3089 Hydrolase_4 Lipase_3 NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ASU79080
UniProt: A0A223RTA4
Position
complement(3000982..3010521)
Genome map
AA seq 3179 aa AA seqDB search
MSSDNDMTEEKLRRYLKRTVTELDSVTARLREVEERAGEPIAIVGTACRFPGGVDSPESF
WEFVSGGGDAITEAPTDRGWAPDPDARLGGMLAAAGDFDADFFGISPREALAMDPQQRIM
LEISWEALERAGHDPGSLRGSSTGVFTGVGAVDYGPRPEEAPEEVLGYVGTGTASSVTSG
RVAYCLGLEGPALTVDTACSSGLTALHLAVESLRRDECERALAGGVTVMSTPGAFAEFRS
QGGLASDGRCKPFSKSADGFGLAEGAGVLVLQRLSVARREGRPVLAVLRGSAVNQDGASN
GLTAPSGPAQQRVIRRALENAGVRTGDVDYVEAHGTGTRLGDPIEAHALLSTYGAEREAD
NPLWIGSVKSNFGHTQAAAGMAGVMKTVLALRHGEVPHTLHFDEPSPQIEWDLGAMSVVS
QPRSWPAGERVRRAGVSSFGISGTNAHVIVEEAPKTDEPESSPESGPVPLVLSGRDERAM
REQAGRLAHHLAREPRDSLRDIGFTLATCRSAWEHRAVVVGDREDVLAGLGAVAEGRLAE
RTSTGQAGTRRGVVMVFPGQGAQWQGMARDLLRESRVFADSIRDCERALAPHVDWSLTEL
LDGARPLERVDVVQPVLFAVMVSLAQLWRSYGVEPAAVVGHSQGEIAAAYVAGALTLEDA
AKLVAVRSRILRRLGGRGGMASFGMSTEQATERIGRFAGALSIASVNGPHSVVVAGERAP
LDELIAECEAEGITARSVPVDYASHSPQVESLREELLTELADIRPVSAGVALYSTTIGQS
VDTATMDTAYWYTNLREQVRFQDTTRQLAEAGFDVFIEVSPHPVLTVAIEATLDSELPAD
ADACVVGTLRRDRGGLADFHAALGAAYTRGVEIDWSPAFADARPVELPAYPFQRQRYWLP
TPTGGRAGDEDNWRYQVVWRDSEWQSTSLAGRVLLVTGPGVSVELSNSVRGGLEQSGATV
LVCEVESRHVIGAALEEADTGALSTVVALLGGEGETVDASLDALALVRALGVAGIEAPLW
VLTRNAVQVTDGELVDPAQAMVGGLGRVVGVEQPSRWGGLVDLIDVDAASVRALAAVLAD
PRGEEQIAIRPDGIKVARFVPAPARAARTRWSPRGTVLVTGGTGGIGAHVARWLARSGAE
HLVLLGRRGADAPGAAELRDELIALGTGVTIAACDVADRERLEEVLAAERAEGRSVNAVL
HAAGISRAAPVEEITETEFAEVAEAKVRGTVNLDELCPDLDAFVLFSSNAGVWGSPGLAC
YAAANAFLDGFARRRRSEGARVSAIAWGLWAGQNMAGDEGGEYLRGQGLRAMEPERAIEE
LHVTLDHGQASVSVVDMDRERFVELFTAARRRPLFDEITGARGEARQSEEDPKLEQRLAA
LSEFERREHVARLVHTEVAAVLGHGDDTMIDRDRAFRDLGFDSMTAVDLRNRLAAVTGVR
EAATVVFDHPNITRLAEHYLEQLVGGAEAEQPPALVRGAEEDADDPIAIVGMACRLPGGV
NNPSELWEFIVGGGDAVTEMPADRGWDLDALFDPDTRRHGTSYSRHGAFLDGATDFDAAF
FGISPREALAMDPQQRQVLETTWELFENAGIDPHSLRGSDTGVFLGAAYQGYGQNAVMPE
DSEGYLLTGNSSAVVSGRVAYVLGLEGPAVTVDTACSSSLVAMHSACSSLREGDCGLAVA
GGVSVMAGPEVFTEFSRQGALSRDGRCKPFSDEADGFGFAEGVAVILLQRLSVARREGRR
VLGVVAGSAVNQDGASNGLSAPSGVAQQRVIRRAWERAGVCGADVGVVEAHGTGTRLGDP
VEASALLATYGRWRGSVGPVLVGSVKSNVGHAQAAAGVVGVIKVVLGLGRGVVPPMVCRG
RWSGLVDWSSGGVELVGGLREWPVGGDGVCRAGVSAFGVSGTNAHVIVAEAPGSGSESGS
GSGSGSVGVLGGVGSVPVLLSAKSETALAAQARLLESVVDESVPLEALASALATERAHLP
HRVALQAGEHEQLRGQLRAVADGVVVPGVVGGGVSGGGSGGGVVFVFPGQGAQWEGMARG
LLSVPVFAESVAECDGVLSEVVGFSVSGVLRGCVGAPSLERVDVVQPVLFVVMVSLARLW
RACGVVPSAVVGHSQGEIAAAVVAGVLSVEDGVRVVALRARALRALAGHGGMISLAASDE
RVRTLIAPWEDRISVAAVNSPSSVVVSGDPAALAELVTRCEDEDVRVKTLPVDYASHSRH
VESIRETVLADLDDVAARPAGIPLYSTLHGERRDGTDMGPLYWYDNLRSQVRFDEAVSAA
VADGNATFVEMSPHPVLTAAVQEIAADAVTIGSLHRDTAEEHLIAELARAHVHGVTVDWR
AVFPATRQVALPNYPFESQRYWIAPEVSDQLAESRYRVDWRPLTTTRVAVEGSFLIHGSA
PESLIRAVEAAGGRVGLLASADSEALGAAVRGIPGEIAGVLSVHTDAATHLALHQSLGEV
GLRVPLWLVTSRAVALGDSEPVDPEQAMVWGIGRVMSLETPERWGGLVDLPVDATPEDVE
AFVACLGVDGHEDQVAIRDRARYGRRLVRAPLETREPSWEPAGTALVTGGTGALGGHVAR
YLARCGVEDLVLVSRRGLDTPGAADLEAELIDLGVKTTITTCDVADREQLTELLEELRGQ
GRPVRTVVHTAGVPESRPLHEIDELESVCAAKVTGARLLDELCPDASTFVLFSSGAGVWG
SANLGAYAAANAYLDALAQRRRSEGRAATSIAWGAWSGAGMATGDLDGLVRRGLRPMEPE
RALRALHQALDNGDTCVSIANVDWDRFAVGFTAARPRPLLDELVTPEAAVPAVRATPVRE
MTTEELLEFTHSHVAAILGHADPDAVGRDQSFTELGFDSLTAVGLRNRLQQATGLTLPAT
LVFDHPTVRRVANHIGQQFDSGKREPAAEASSALRDGYRQAGLSGRVRPYLDLLAGLSDF
REHFDGSDDFVTDLVELADGAGEVTVICCAGTAAISGPHEFTRLAGELCGTVPVRAVPQP
GYEDGQPLPSSMAAVVAVQADAVIRAQDGKPFVLVGHSAGALMAYALATELLDRGHPPRG
VVLIDVYPPGNQDAMNAWLEELTTTLFDRETVRMDDTRLTALGAYDRLTAQWRPRDTGLP
TLLVSASEPMGPWPDDSWKPTWPFEHETVAVPGDHFTMMQEHADAIARHIDVWLGGGSQ
NT seq 9540 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgacaacgatatgacagaggaaaagctccggcgctacctcaagcgcaccgtc
accgagctcgactcggtgaccgcgcgcttacgggaggtcgaggagcgggccggtgagccg
atcgcgatcgtcggcacggcatgccggttccccgggggcgtggactcaccggagtcgttc
tgggaattcgtctccggcggtggggacgccatcaccgaggccccgaccgatcgcggttgg
gcaccggatcccgatgcccggctgggtgggatgctcgcggccgcgggcgacttcgacgcg
gactttttcgggatctcaccgcgcgaggcgctggcgatggatccgcagcagcgcatcatg
ttggagatctcctgggaggcgctggaacgcgccggccacgatcccggttccctgcgcggc
agctcgacgggagtgttcaccggtgtcggtgccgtggactacggtcctcgccccgaggag
gccccggaagaggtcctcggctatgtcggcactggtaccgcttccagcgtcacctctggc
cgcgtcgcctactgcctgggcctggaggggcccgcgctcacggtcgacaccgcctgctcc
tccgggctcaccgccctgcacctggctgtggagtcgctgcgccgtgacgaatgcgagcgg
gcattggccggcggcgtgacggtgatgagcactcccggggcgttcgccgaattccgcagc
cagggcgggctggcttccgacggccgctgcaagccgttctcgaagtccgccgacgggttc
gggctggccgagggggccggtgtcctggtactgcaacggctttcggtcgcgcggcgggag
ggccggcccgtgctggccgtgctgcgtggttcggcggtcaaccaggacggcgccagtaac
gggctgaccgcgcccagtggtcccgcgcagcagcgggtcatccgtcgggcgctggagaac
gccggtgtccggacgggtgatgtggactacgtggaggcccacggcactggcacccggctg
ggtgaccccatcgaggcgcacgcgttgctctcgacctacggagcggaacgcgaagctgat
aatccactgtggatcggttcggtcaagtccaacttcggccacacccaggccgccgcgggc
atggccggagtgatgaagacggtgctggcgctacggcacggcgaggtgccgcacacactg
cacttcgacgagccctcaccgcagatcgagtgggacctgggcgcgatgtcggtggtgtcg
cagccgcggtcgtggcccgccggtgagcgggtgcgcagggcgggcgtctcctcgttcggc
atcagcggcaccaatgcgcacgtcatcgtcgaggaggcaccgaagaccgacgagcccgag
tcgtcccccgagtccgggccagtcccactggtgctgtcaggccgcgacgagcgggccatg
cgggagcaggcaggcaggctggcccaccacctggcccgcgagccgcgtgactcgttgcgc
gacatcggtttcacgctggccacctgccgcagcgcctgggaacaccgcgcggtggtggtc
ggcgaccgcgaggacgttctcgccgggctgggcgcggtggccgagggccgcctcgccgag
cggacgagcacgggccaggccggaacccgtcgcggtgtcgtgatggttttccccggtcag
ggggcccagtggcagggcatggcccgtgacctgttgcgggaatcccgggtgttcgccgac
tcgatccgtgattgcgagcgcgcgctcgccccgcacgtcgactggtcgttgaccgagctg
ctcgacggcgcgcggccgttggagcgggtcgacgtggtgcagccggtgttgttcgcggtg
atggtctcgttggcgcagctgtggcgctcctacggggtcgagccggccgcggtggtcggg
cattcgcagggtgagatcgccgccgcctacgtcgccggggcgctcacgctggaggacgcg
gcgaaactcgtggcggtccgcagccgaatcctgcgccgtcttggtgggcggggcggcatg
gcgtcgttcgggatgagtaccgagcaggcgaccgagcggatcgggcgcttcgccggtgcg
ctctccatagcctcggtcaacgggccccactcggtggtcgtcgcgggggagagagcgccg
ctggacgagttgatcgccgaatgcgaagccgaaggcatcacggcgcgcagcgtccccgtc
gactacgcttcccattcaccgcaggtcgagtcgctgcgcgaggagttgctgaccgagctg
gcggatatccgcccggtgtcggcgggcgtcgcgctctattcgacgacgatcgggcagtcc
gtggacacggccacgatggacaccgcttactggtacacgaacctgcgcgagcaggttcgc
ttccaggacacgacgcggcaactcgccgaggcaggattcgatgtgttcatcgaggtcagc
ccacatccggtgctgaccgtcgctatcgaggcaacactggactccgagcttccggccgat
gccgacgcatgtgtcgtgggcacgctgcggcgggaccgcggcggcttggccgacttccac
gccgcgctgggcgcggcgtacacgcggggcgtggagatcgactggagccccgccttcgcc
gacgcacggccggtcgagttgcccgcctacccgttccagcggcagcggtactggctgccg
acccccaccggtgggcgagcgggagatgaggacaactggcgctaccaggtcgtgtggcgg
gactcggagtggcagagcacttcgttggccggacgcgtactgctcgtgaccggaccgggt
gtctcggtcgagctgtcgaactcggtccgcgggggactggagcagagcggtgcgacggtc
ctggtctgcgaggtggaatcccgccacgtcatcggtgcggcattggaggaggccgacacc
ggtgccctgtcgactgtggtcgctctgctgggcggcgaaggcgaaacggttgacgcttcg
ctggacgcgctcgccctggtgcgggcactcggcgtggcggggatcgaagcaccgctgtgg
gtgctgacgcgcaacgccgtgcaggtgaccgacggcgagctggtcgatccggcgcaagcc
atggtgggtggtctcggccgcgtggtcggcgtcgaacaaccgagccgttggggtggtctg
gttgacctgatcgacgtcgacgccgcgtcggtccgggcgctggccgcggtgctggccgac
ccgcgtggtgaggagcagatcgcgatccggccggacggcatcaaggtggcacgcttcgtt
cccgctcccgctcgtgccgcacgcacccgttggagtccgcgcggcaccgtgctggtcaca
ggcggtactggaggcatcggcgcacacgtcgcccgctggctggcccgctcgggcgccgag
cacctggtgctgctgggcaggcgtggtgccgacgcacccggtgcggccgagctgcgggat
gaactgatcgcgctcggcacgggcgtaaccatcgccgcctgcgacgtcgccgatcgggag
cggctggaggaagtgctcgccgcggagcgtgccgagggacgctcggtcaacgccgtgctg
cacgcggcggggatctccagggcggctcccgtcgaggagatcaccgagaccgagttcgcc
gaggtcgcagaagccaaggtacgcggcacggtcaacctcgatgaactgtgcccggatctc
gacgccttcgtgctgttctcgtccaacgcgggtgtatggggcagcccggggctcgcctgc
tacgcggcggccaacgccttcctggacggattcgcgcggcgacgtcggagcgagggcgcg
cgggtgtccgccatagcctgggggctctgggccgggcagaacatggccggggatgaaggc
ggcgagtacctgcgcggtcaggggttgcgggcgatggaacccgagcgggccatcgaggag
ctgcacgtcaccctggaccacggtcaggcaagcgtgtccgttgtggacatggatcgcgaa
cggttcgtcgagctgttcaccgcggctcggcgtcgcccgttgttcgacgagatcaccggc
gcgcggggggaggcccggcagagcgaggaggacccgaagctggagcagcggctcgcggcg
ttgtcggagttcgagcggcgtgagcacgtcgcccggctggtccacaccgaggtggccgcg
gtgctcggtcatggcgacgacacgatgatcgaccgcgaccgcgccttccgcgacctcggc
ttcgactccatgaccgccgtcgacctgcgtaaccggctcgccgcggtgaccggagtgcgg
gaagccgcgacggtggtcttcgaccacccgaacattacccggctcgccgagcactacctg
gagcagctcgtcggaggagccgaggcggagcaacccccggcgctcgtgcgcggggcggag
gaggatgccgacgacccgatcgcgatcgtgggcatggcctgccgcttgcccggcggcgtg
aacaaccccagcgagttgtgggagttcatcgtcggtggtggagacgccgtgacggagatg
cccgctgatcggggctgggacctcgacgcgctgttcgatcccgatacgcggcgccacggc
accagctactcccgccacggtgcgttcctcgacggggccaccgacttcgatgcggcgttt
ttcgggatctcgccgcgtgaggcgttggcgatggatccgcagcaacggcaggtactcgag
acgacgtgggaactgttcgagaacgcggggatcgatccgcactcactgcggggaagtgac
accggcgtcttcctcggcgcggcttaccagggctacggacagaacgcggtgatgcccgag
gacagcgagggttatctgttgacgggtaattcgtctgctgtggtgtctggtcgtgttgcg
tatgtgttggggttggagggtcctgcggtgacggtggatacggcgtgttcgtcgtcgttg
gtggcgatgcattcggcgtgttcgtcgttgcgggagggggattgtggtcttgcggtggcg
ggtggtgtgtcggtgatggcgggtccggaggtgtttacggagttttcgcggcagggtgcg
ttgtcgcgggatgggcggtgtaaaccgttctcggacgaagccgacggattcggcttcgcc
gagggcgtcgctgtgatcttgcttcagcggttgtcggtggcgcggcgggaggggcgtcgt
gtgttgggtgtggtggctgggtcggcggtgaatcaggatggtgcgagtaatgggttgtcg
gcgccgagtggggtggcgcagcagcgggtgattcgtcgggcgtgggagcgggctggggtg
tgtggtgctgatgtgggggtggtggaggcgcatgggacggggacgcggttgggggatccg
gtggaggcgtcggcgttgttggcgacgtatggccggtggcgggggtcggtgggtccggtg
ttggtggggtcggtgaagtcgaatgtgggtcatgcgcaggcggctgcgggggttgttggt
gtgatcaaggtggtgttggggttgggtcgtggtgtggtgccgccgatggtgtgtcgtggt
cggtggtcggggttggtggattggtcgtcgggtggggtggagcttgttggggggctgcgg
gagtggccggttggtggggatggtgtgtgtcgggctggggtgtcggcgtttggggtgagt
gggacgaatgcgcatgtgattgtggctgaggcgccgggttcggggtcggagtctgggtct
gggtctgggtctgggtcggtgggtgtgttggggggtgtggggtcggtgccggtgttgctg
tccgccaaaagcgagacggcgttggcggcccaggcacgactactcgaatccgtggtggac
gagtcggttcccctggaggcgttggcttcagcgttggccactgaacgagcgcacctaccg
caccgtgtggcgttgcaggcgggcgagcacgagcagctccgcggtcagttgcgtgcggtg
gctgatggtgtggtggttcctggtgttgtgggtggtggggtgtctggtggggggtctggt
gggggtgtggtgtttgtgtttccggggcagggtgctcagtgggaggggatggctcggggg
ttgttgtcggtgcctgtgttcgctgagtcggtggctgagtgtgatggggtgttgtcggag
gtggtggggttttcggtgtctggggtgttgcgggggtgtgtgggggcgccgtcgttggag
cgggtggatgtggtgcagccggtgttgttcgtggtgatggtgtcgttggcgcggttgtgg
cgtgcgtgtggtgttgttccgtcggcggtggtggggcattcgcagggtgagatcgcggcg
gcggtggtggctggggtgttgtcggtggaggacggtgttcgtgtggtggcgttgcgggcg
agagcgttgcgtgccctggccggccacggcggcatgatctcgctggccgcttccgacgag
cgcgtccgaacactgatcgcaccgtgggaggatcggatctccgtcgcggcggtcaactcc
ccgtcctcggtcgtggtctccggcgatccggcggcgctggccgaactggtcactcgttgc
gaggacgaggacgtgcgggtcaagacactcccggtggactacgcctcgcactcccggcac
gtggagagcatccgcgagacggtcctggccgatctcgacgacgtcgccgcgcggcccgcc
ggcatcccgctctattccacactgcacggtgaacgtcgcgacggcacggacatggggccg
ctgtactggtacgacaacctgcgttcccaggtgcgtttcgacgaagcggtatcggccgcc
gtcgccgacgggaacgccaccttcgtcgagatgagcccgcacccagtgctcaccgcggcg
gttcaggagatcgccgcggacgccgtgaccatcgggtcgctgcaccgcgacaccgcggag
gagcacttgatcgccgagctcgcccgcgcgcacgtgcacggagtgaccgtggactggcgg
gctgtcttcccggcaacgcgtcaggtggcgctgcccaactaccccttcgagtcccagcgg
tactggatcgcaccggaggtgtccgatcagctggccgagagccgttaccgcgtcgactgg
cgaccgctgaccaccacccgggtggctgtggagggcagcttcctgatacacgggtccgcg
cccgaatcgctgatcagagccgtcgaggcggccggaggtcgcgtcgggttgctcgcctcg
gccgattccgaagcgctcggggcggccgtacgggggattcccggtgagatcgccggcgtg
ctctcggtccacaccgacgcggcaacgcacctcgccctccaccagtcgttgggtgaagtt
ggcctccgggtgccgctctggctggtcaccagccgagccgtcgcgctcggggattccgaa
cctgtcgatcccgaacaggcgatggtgtggggcatcggacgtgtcatgagtctggagacg
ccggagcggtggggtggactggtggatctgccagtcgacgctacgccggaggacgtcgag
gcgttcgtcgcctgcctcggcgtagacggtcacgaggaccaggtcgcgatccgcgaccga
gcccgttacgggcgccgcctcgtccgcgccccgctggaaacccgtgagccgagctgggaa
cccgcgggcacggcgctggtcaccggcggtaccggtgcgctcggtggtcacgtcgcccgt
tacctcgccaggtgcggtgtggaggacttggtgctcgtcagcagacgcggcctcgacacg
cccggtgcggccgacctggaagccgaactgatcgacctcggcgtgaagacgaccatcacc
acctgcgacgtcgccgaccgcgagcaactcaccgagctactggaggagctgcgcgggcag
ggacgcccggttcggaccgtcgtgcacaccgccggggttcccgagtcgaggccactgcac
gagatcgacgagctggagtcggtctgcgctgcgaaggtgaccggagcccggctgctcgac
gagctgtgcccggacgccagcaccttcgtcttgttctcctccggagccggggtctggggc
agtgcgaacctcggcgcttacgccgcggccaacgcttatctcgacgcgctggcccaacga
cgtcgatccgagggacgggcggcgacgtccatagcgtggggcgcctggtcgggggcgggc
atggccaccggcgacctggacggactcgtccgccgcggcctgcgcccgatggagcccgag
cgcgcgctccgcgcactgcaccaggcgttggacaacggtgacacgtgcgtgtcgatcgcc
aatgtggactgggatcgcttcgctgtcggcttcaccgccgcccgcccgagaccgttgctc
gacgagctcgtcacgcccgaggcggcggttccagcggtgcgggcgacgccggtgcgggag
atgacgaccgaagagctgctggagttcacgcactcgcacgtcgcggcgatcctcgggcac
gccgacccggacgcggtcggtagggaccagtcgttcaccgagctcggcttcgactcgctg
accgctgtcgggctgcgcaaccggttgcagcaggccaccgggctgacgctgcccgcgacg
ttggtgttcgaccaccccactgtccgcagggtcgccaaccacatcggacagcagttcgac
agcgggaagcgcgagcccgctgcggaagcgagcagtgcgctgcgtgacggttatcggcag
gcgggtctgtcgggccgagtccggccctatctcgacctgctggccgggctctcggacttc
cgtgagcacttcgacggttccgacgatttcgtcaccgatctcgtagagctggctgacggt
gccggagaggtcacggtgatctgctgcgcgggaacggccgcgatctccggtccgcacgag
ttcacccgactcgccggggagctgtgtggaaccgttccggtgcgggccgttccccaaccc
ggctacgaagatggccaaccactgccttcgtccatggcggcggtggtcgccgtgcaggcc
gatgcggtcatccgggctcaggacggcaagccgttcgtgctggtcggccactccgctgga
gcgctgatggcctacgcgctggcgactgaactgctcgaccgcggccatccaccacgcggt
gtcgtgctcatcgacgtttacccgccaggaaaccaggacgcgatgaacgcctggttggag
gagctgacgaccacgttgttcgaccgcgagacggtccggatggacgacacccggctcacc
gcgctgggtgcctacgatcgcctcaccgcccagtggcggccccgcgacaccggtctgccg
acgttgttggtgagcgccagcgaaccgatggggccgtggcccgatgacagctggaaaccg
acatggcccttcgaacacgagaccgtcgccgtccccggagatcacttcacgatgatgcag
gaacacgccgacgcgatcgcgcggcacattgacgtctggctgggcggaggaagtcaatga

DBGET integrated database retrieval system