KEGG   Aeromicrobium sp. 592: C3E78_16900Help
Entry
C3E78_16900       CDS       T05410                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
aez  Aeromicrobium sp. 592
Pathway
aez00020  Citrate cycle (TCA cycle)
aez00620  Pyruvate metabolism
aez01100  Metabolic pathways
aez01120  Microbial metabolism in diverse environments
aez01200  Carbon metabolism
aez01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aez00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C3E78_16900
   00620 Pyruvate metabolism
    C3E78_16900
Enzymes [BR:aez01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     C3E78_16900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C ATP-grasp_3 Biotin_lipoyl_2 HlyD_3 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AWB93754
UniProt: A0A2S0WR92
Position
complement(3481579..3484959)
Genome map
AA seq 1126 aa AA seqDB search
MFQKILVANRGEIAIRAIRAAHELGAQTVAVFPYEDRGSEHRVRADEAYEIGERGHPVRA
YLDPEGIVAAAVAAGADAIYPGYGFLSENPDLAEACEQAGITFIGPSREVLELTGNKASA
IAAARSAGVPTLRSVEPSADVDELVASSDALTYPLFVKAVAGGGGRGMRKVDDPARLRES
IEAAMREADGAFGDPTCFIEEAVVDARHIEVQVLADSVGSVVHLRERDCSVQRRHQKVVE
IAPAPHLPVEVREAMCADAVRFAESIGYSCAGTVEFLLGADHRYVFIEMNPRIQVEHTVT
EEVTGVDLVQAQMEIAAGATLVDLGLDVQDSITARGFALQCRITTEDPANGFRPDTGTIT
SYRSPGGPGVRLDGGTAFTGAVVSPHFDSMLSKLTCRGRDFEAAVTRAERALSEFHVGGV
STNIGFLQGLLADPDFRAGRVTTSFIEEHPALLQAHGAADPAGKILSWLADVTVNKPHGT
SPTTVDPVSKLPQLDLTAAAPDGSRQLLAELGPDGFAAALRQRDTVGVTDTTFRDAHQSL
LATRVRTRDLVQVAPYVARMTPQLLSIEAWGGATYDVALRFLKEDPWDRLAAMREAAPNI
CLQMLLRGRNTVGYTPYPTEVTDAFVAEAAATGIDIFRIFDALNDVDQMRPAIEAVRATG
TAVAEVALCYTGDLSDPGETLYTLDYYLDLAERIVDAGAHVLAIKDMAGLLRAPAARTLV
RGLRERFDLPVHLHTHDTPGGQLATLVAAIEAGVDAVDAASAALAGTTSQPPMSALVAAT
DHSERTTGLDIAAVNALEPYWEATRRLYAPFESGLPAPTGRVYRHEIPGGQLSNLRQQAI
ALGLGEKFEQIEDMYAAANDILGNVVKVTPSSKVVGDLALHLVAVGADPEAFADDPASFD
IPESVIGFLSGELGDPPGGWPEPFRTKALEGRSVRTRVEELSDQDRDGLAVDRRHTLNRL
LFPGPTQDFDQARAEYGDLSAVPTEAFLYGMRSGEETEVEVSEGNLLLFGVEAIGEADER
GVRNVLGTINGQLRPTQVRDRSVDSKVAAAEKADTRNAQHVAVPFAGVVHALVAEGDVVV
AGQTVATIEAMKMEASITTANAGTVVRLVISEHRQVEGGDLLLVLE
NT seq 3381 nt NT seq  +upstreamnt  +downstreamnt
ttgttccagaagattctcgtcgccaaccgtggggagatcgcgatccgcgcgatccgcgcc
gcccacgagctgggcgcccagaccgtcgcggtgttcccctacgaggaccgcgggtccgag
caccgtgtccgcgccgacgaggcgtacgagatcggcgagcgcggccaccccgtgcgggcc
tacctcgaccccgagggcatcgtcgctgcggcggtggctgcaggggccgacgcgatctac
ccggggtacggcttcctgtccgagaaccccgacctcgcggaggcctgcgagcaggcgggc
atcacgttcatcgggccgtcgcgcgaggtgctggagctgactggcaacaaggcgtcggcg
atcgctgctgcgcggtcggccggcgtcccgacgctcaggtcggtcgagccgtccgccgac
gtcgacgagctcgtggcgagctcggatgcgctgacgtacccgttgttcgtcaaggcggtg
gccggcggcggtggccgcggcatgcgcaaggtggacgatcccgcacggctgcgtgagtcg
atcgaggccgcgatgcgcgaggccgacggggcgttcggcgacccgacctgcttcatcgag
gaagccgtggtggacgcccggcacatcgaggtgcaggttcttgccgactccgtcggctca
gtggttcatctgcgggagcgggactgctcggtgcagcgtcgccaccagaaggtcgtggag
atcgcccccgcaccgcacctgccggtcgaggtccgggaggcgatgtgcgccgacgcggtg
cggttcgcggagtcgatcggctactcgtgcgccggcacggtggagttcctgctcggcgcg
gaccaccgctacgtgttcatcgagatgaacccgcggatccaggtcgagcacaccgtgacc
gaggaggtcaccggtgtcgacctggtgcaggcacagatggagatcgcggcgggcgcgacg
ctcgtcgacctcggcctggacgtccaggactccatcactgcccgcggtttcgccctgcag
tgccggatcacgaccgaggacccggccaacgggttccgccccgacaccggcaccatcacg
tcgtaccgctcaccgggtggtccgggcgtgcgcctcgacggcggcaccgcgttcaccggg
gccgtggtcagcccgcacttcgactcgatgctgtccaagctgacctgtcgtggtcgcgac
ttcgaggccgcggtgacccgcgcggagcgcgccctgagcgagttccacgtgggtggggtg
tcgaccaacatcggcttcctgcaggggctgctggccgacccggacttccgcgcgggccgg
gtcaccacgtcgttcatcgaggagcaccccgccctgctgcaggcgcacggtgccgccgac
cccgccggcaagatcctgtcctggctcgcggacgtcacggtcaacaagccgcacggcacc
tcgccgaccactgtcgacccggtatcgaagctgccgcagctggacctgacggcagcggcg
ccggacggctcgcgtcagctgctcgccgagctggggcccgacggcttcgcggctgccctg
cgccagcgcgacacggtcggggtcaccgacaccacgttccgcgacgcgcaccagtcgctg
ctggcgacgcgcgtgcggacccgtgacctggtgcaggtcgcgccgtacgtcgcccggatg
acgccgcagctgctctcgatcgaggcctggggcggggcgacgtacgacgtcgcgctgcgg
ttcctcaaggaggacccgtgggaccggctcgcggcgatgcgcgaggcggcgcccaacatc
tgtctgcagatgctcctgcgcggtcgcaacacggtcggctacacgccgtacccgaccgag
gtcaccgacgcgttcgtcgccgaggccgccgcgaccggcatcgacatcttccgcatcttc
gacgcgctcaacgacgtcgaccagatgcgccccgcgatcgaggcggtccgggccaccggc
acggcggtcgcggaggtcgcgctctgctacaccggcgacctgtccgacccgggggagacg
ctctacacgctggactactacctggacctcgccgagcgcatcgtcgacgccggcgcccac
gtcctggcgatcaaggacatggccggcctgctgcgggcgccggcagcccggacgctcgtg
cgcggcctgcgtgagcggttcgacctgcccgtgcacctgcacacgcacgacaccccgggt
ggccagctcgcgacgctcgtcgcggcgatcgaggccggtgtcgacgcggtggacgccgcc
tccgccgcgctggccggcacgacgtcgcagccgccgatgtccgcgctggtcgcggcgacc
gatcactccgagcgcacgacggggctcgacatcgcggccgtcaacgcgctggagccgtac
tgggaggccacccggcgcctctacgcgccgttcgagtccggtctgccggcgccgaccggg
cgggtctaccgccacgagatccccggtgggcagctgtccaacctgcgccagcaggcgatc
gccctgggcctgggggagaagttcgagcagatcgaggacatgtacgccgcggccaacgac
atcctcggcaacgtcgtcaaggtgaccccctcgtccaaggtggtcggcgacctggccctg
cacctcgtcgcggtgggtgccgaccccgaggcgttcgcggacgacccggcgtcgttcgac
atccccgagtccgtgatcggctttctctccggggagctcggggacccgcccggcggctgg
cccgagccgttccggaccaaggcgctggagggacgctcggtcaggacgcgggtcgaggag
ctgtccgaccaggaccgcgacggcctcgcggtggaccgccgccacaccctcaaccggctg
ctgttcccggggccgacgcaggacttcgaccaggcgcgtgccgagtacggcgacctgagc
gcggtgcccaccgaggcgttcctctacggcatgcggtcgggtgaggagaccgaggtcgag
gtctcggaagggaatcttctgctgttcggcgtcgaggccatcggcgaggcggacgagcgc
ggagtccgcaacgtcctcggcacgatcaacggtcagctccggccgacccaggtgcgcgac
cgctcggtggactccaaggtcgcagccgccgagaaggccgacacccgcaacgcccagcac
gtcgcggtgccgttcgccggtgtcgtccatgcgctcgtcgccgagggcgacgtcgtggtg
gcgggtcagaccgtggccacgatcgaggcgatgaagatggaggcgtcgatcacgaccgcg
aacgccgggacggtggtgcgcctcgtgatctccgagcaccgccaggtcgagggtggcgac
ctcctgctcgtcctggagtga

DBGET integrated database retrieval system