KEGG   Alcaligenes faecalis ZD02: UZ73_05185Help
Entry
UZ73_05185        CDS       T04157                                 

Definition
(GenBank) histidine ABC transporter permease
  KO
K10016  histidine transport system permease protein
Organism
afa  Alcaligenes faecalis ZD02
Pathway
afa02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:afa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    UZ73_05185
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:afa02000]
    UZ73_05185
Transporters [BR:afa02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    UZ73_05185
   Histidine transporter
    UZ73_05185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF1440 EII-GUT
Motif
Other DBs
NCBI-ProteinID: ALO37711
UniProt: A0A0S2JP60
Position
1136580..1137269
Genome map
AA seq 229 aa AA seqDB search
MLLYGYGPQLLVGTWETIKLAVLSLLVSLVLGLVAALMKLSRASLLRWVGGLYTTLIRGV
PDLVLLMLFFFSLQIWLNELTDWLEWDMIEIDPFGAGVVTLGFIYGAYFAETFRGALMAI
PKGQMEAGKACGWSAWQVLHRIQIPQMMRYALPGLGNNWQILLKSTALVSLIGLSDVVKI
AQNAGNATFNSFLFVGITALIYLGLTAVSNIGLGYLERRYNIGVKGAQF
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgttgctttacggttatgggccgcagttgctggtcggcacctgggaaaccatcaaactg
gccgtgctctcactgctggtttccctggtgctgggtctggtcgctgccctgatgaaactg
tcccgcgcctcgctgctgcgttgggtgggcggtttgtataccaccttgatccggggcgtc
ccggacctggtgctcttgatgctgttctttttcagcctgcaaatctggctgaacgagctg
actgactggctggaatgggacatgatcgagatcgatccctttggcgccggtgtggtcacg
ctgggctttatttatggcgcttactttgccgaaaccttccgtggcgccctgatggccatc
cccaagggccagatggaagccggcaaggcctgtggctggagcgcctggcaggttttgcac
cgcatccagatcccacaaatgatgcgctacgcattgcccggactgggcaacaactggcaa
atcctgctcaaatccaccgcgctggtgtccctgatcggcctgagcgatgtggtcaagatt
gcgcaaaacgccggtaacgcaaccttcaactccttcttgtttgtcggcatcaccgccctg
atctatctgggcctgactgccgtcagcaatatcgggctgggctacctggaacgacgctac
aacattggcgtgaaaggagcacagttctaa

DBGET integrated database retrieval system