KEGG   Alcaligenes faecalis ZD02: UZ73_05530Help
Entry
UZ73_05530        CDS       T04157                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
afa  Alcaligenes faecalis ZD02
Pathway
afa00071  Fatty acid degradation
afa00072  Synthesis and degradation of ketone bodies
afa00280  Valine, leucine and isoleucine degradation
afa00310  Lysine degradation
afa00362  Benzoate degradation
afa00380  Tryptophan metabolism
afa00620  Pyruvate metabolism
afa00630  Glyoxylate and dicarboxylate metabolism
afa00640  Propanoate metabolism
afa00650  Butanoate metabolism
afa00900  Terpenoid backbone biosynthesis
afa01100  Metabolic pathways
afa01110  Biosynthesis of secondary metabolites
afa01120  Microbial metabolism in diverse environments
afa01130  Biosynthesis of antibiotics
afa01200  Carbon metabolism
afa01212  Fatty acid metabolism
afa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:afa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    UZ73_05530
   00630 Glyoxylate and dicarboxylate metabolism
    UZ73_05530
   00640 Propanoate metabolism
    UZ73_05530
   00650 Butanoate metabolism
    UZ73_05530
  09103 Lipid metabolism
   00071 Fatty acid degradation
    UZ73_05530
   00072 Synthesis and degradation of ketone bodies
    UZ73_05530
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    UZ73_05530
   00310 Lysine degradation
    UZ73_05530
   00380 Tryptophan metabolism
    UZ73_05530
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    UZ73_05530
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    UZ73_05530
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    UZ73_05530
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:afa04147]
    UZ73_05530
Enzymes [BR:afa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     UZ73_05530
Exosome [BR:afa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UZ73_05530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt Esterase_phd Ketoacyl-synt_C
Motif
Other DBs
NCBI-ProteinID: ALO37770
UniProt: A0A0S2JP04
Position
complement(1217104..1218273)
Genome map
AA seq 389 aa AA seqDB search
MSGHACIVGWAHTPFGKLDNIDIEELIQAVVRDSIAHAGIQASDIDFAAVGVYNNGLNPQ
GFEAGLLSLHQPDLRFTPAVHVENACATGSAAIHSVMDAIEGGRARIGIAVGAEKMTGVP
PTRIPEILSSGCYRKEEDNPLGFAGIFGQITQAYFDRYGDHSHSLAQIAAKNHINALANP
YAHVRRDLGLEFCDQVSEKNPLVAGPLRRTDCSMVSDGAAALVLADEETARALRRAIRFR
SRVQVNDFMPLSRRDPIAFEGAHRAWQQALSKAGVGILDLDLVETHDCFTTAEMLEYEAM
GLAPRGEGWKVILEGRTRKDGQLPVNVSGGLKARGHPLGATGVSMHVMAAMQLAQEAGDM
QLPQAELAGIFNMGGAAVANYVSILERLK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtctggacacgcatgtattgtgggatgggcacataccccgtttggaaagctggataac
atcgacattgaagaattgattcaagccgtggtcagggattcgattgcgcacgcaggcata
caggccagcgacatcgattttgcggccgtgggtgtctacaacaatggtttgaaccctcaa
gggtttgaggccggattgctgtccctgcatcagcctgatctgcgtttcacgcctgccgta
cacgtggaaaatgcgtgcgccacgggtagtgccgccattcatagcgtgatggatgccatt
gaaggtggccgtgcccgcatcgggattgctgttggtgcagaaaaaatgacgggtgtgcca
cctacccgcatccctgaaattctcagctctggttgctatcgcaaggaagaggacaatccg
ctggggtttgcgggaatctttggtcagatcactcaggcgtactttgatcgctatggtgat
cacagccattccctggcgcagattgccgccaagaaccatatcaatgccttggccaatcct
tacgctcatgtacgccgtgacctgggcctggagttctgcgatcaggtttcggaaaagaat
cctttggttgctggcccgctgcgtcgtaccgactgctccatggtgtccgatggtgctgcc
gccctagttctggcggatgaagaaaccgcccgtgccttgcgccgcgcgattcgcttccgt
tcccgtgtgcaggtaaacgacttcatgcctttgtcgcgccgcgacccgattgcgtttgaa
ggggcgcatcgtgcttggcagcaggctttgtccaaagccggtgtgggcattctggatctg
gatctggtggaaacccatgactgctttaccaccgctgaaatgctggagtatgaagccatg
ggtctggctccgcgtggcgagggctggaaagtgattctggaaggtcgcacccgtaaagat
ggtcagttgccagtgaacgtgtctggcggcttgaaagcacgcggtcaccctctgggcgca
actggcgtttctatgcatgtgatggcagctatgcagctggctcaggaagcgggtgatatg
caattgccgcaagcagaactggctggcatcttcaatatgggtggtgcggctgtggccaac
tatgtctcgattctggaacgcttgaaatga

DBGET integrated database retrieval system