KEGG   Alcaligenes faecalis ZD02: UZ73_09245Help
Entry
UZ73_09245        CDS       T04157                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
afa  Alcaligenes faecalis ZD02
Brite
KEGG Orthology (KO) [BR:afa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    UZ73_09245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 CARDB DUF4354
Motif
Other DBs
NCBI-ProteinID: ALO38433
UniProt: A0A0A2NBQ6
Position
complement(2045310..2045684)
Genome map
AA seq 124 aa AA seqDB search
MKPDDIEVQITPQYLPEQSEPDSNQYVFAYTVRITNNGQQTAQIISRHWIITDDNQQVQE
VRGLGVVGQQPVLAPGETFEYTSGCPLNTPFGTMRGSYQCVGENGVPFEVAIQEFILSSP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctgacgatattgaggtgcagatcacgccccagtacctgcctgagcaatccgag
cccgatagcaatcaatacgtttttgcctataccgtacggattaccaacaatggacagcag
acggcacagatcatcagtcgtcactggatcattacggatgacaatcagcaggttcaggaa
gtgcgtggcctgggggttgtgggacagcagccggtgctggctccaggcgagacctttgag
tacaccagtggctgccccttgaacacgccttttggcaccatgcgcggcagctatcaatgt
gttggtgaaaatggtgtgccctttgaggtcgccattcaggagttcatcctttcctccccc
cgtaccttgcactaa

DBGET integrated database retrieval system