KEGG   Alistipes finegoldii: Alfi_1746Help
Entry
Alfi_1746         CDS       T02133                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
afd  Alistipes finegoldii
Pathway
afd00010  Glycolysis / Gluconeogenesis
afd00051  Fructose and mannose metabolism
afd00562  Inositol phosphate metabolism
afd01100  Metabolic pathways
afd01110  Biosynthesis of secondary metabolites
afd01120  Microbial metabolism in diverse environments
afd01130  Biosynthesis of antibiotics
afd01200  Carbon metabolism
afd01230  Biosynthesis of amino acids
Module
afd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
afd_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:afd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alfi_1746
   00051 Fructose and mannose metabolism
    Alfi_1746
   00562 Inositol phosphate metabolism
    Alfi_1746
Enzymes [BR:afd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Alfi_1746
Exosome [BR:afd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Alfi_1746
  Exosomal proteins of bladder cancer cells
   Alfi_1746
  Exosomal proteins of melanoma cells
   Alfi_1746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFL78077
UniProt: I3YM59
Position
complement(1956677..1957435)
Genome map
AA seq 252 aa AA seqDB search
MRKKIVAGNWKMNTLPAEGVELAKNIVAGRGEVCSCVNFIVCPPFTHLSTVAEALKGSDV
ALGAQNCAAEAKGAYTGEIAASMIAALGCKYVILGHSERRQYYGETSETLNKKMAQAYAN
GLTPIYCVGENLEEREAGKHFDVVKAQIEEVVYNLTAEQYKELVIAYEPVWAIGTGKTAT
AEQAQEIHAYIRKVLAEKFGAAAEETAILYGGSCKPSNAAEIFAKEDVDGGLIGGAALKA
EDFLGIGKGFAK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagaaaattgttgccggcaactggaagatgaacacgcttcccgccgaaggtgta
gaactggccaagaacatcgtcgcaggccgcggcgaagtatgctcgtgcgttaatttcatc
gtatgccctccgtttacgcacctctcgacggttgccgaagcgctcaagggttcggacgtc
gcactcggcgcgcagaactgcgcagccgaagccaaaggcgcctacacgggcgagatcgcc
gcttcgatgatcgcggcgctgggctgcaagtacgtgatcctcggccactcggagcgccgc
cagtactacggcgagacttccgagacgctcaacaagaagatggcgcaggcttacgcaaac
ggcctgacgccgatctactgcgtgggcgagaacctcgaagagcgtgaagccggcaagcac
ttcgacgtggtgaaggcgcagatcgaagaggtcgtctacaacctcaccgccgagcagtac
aaggagctcgtgatcgcatacgaacccgtttgggccatcggcacgggcaagaccgcaacg
gccgagcaggcgcaggagatccacgcctacatccgcaaggtgctggccgagaagttcggc
gcagcagccgaagagacggcgatcctgtacggcggttcgtgcaagccctcgaacgcggcg
gaaatcttcgcaaaggaggacgtggacggcggtctgatcggcggcgcagccctcaaggcg
gaggacttcctcggcatcggcaaaggctttgcgaaataa

DBGET integrated database retrieval system