KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_0257Help
Entry
Lferr_0257        CDS       T00758                                 

Definition
(GenBank) Conjugal transfer protein TrbG/VirB9/CagX
  KO
K20532  type IV secretion system protein TrbG
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:afe00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Lferr_0257
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:afe02044]
    Lferr_0257
Secretion system [BR:afe02044]
 Type IV secretion system
  Trb secretion system protein
   Lferr_0257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CagX
Motif
Other DBs
NCBI-ProteinID: ACH82515
Position
244153..245253
Genome map
AA seq 366 aa AA seqDB search
MKTKTLLSLGLAVLPGLALAGVDTGLPAVNPISSLQGKPPIQPAGTKTGSAHPSTTPSAS
GGTTSAGQKVPAISPEAAARMATAHVWQQSIATPPEGPESAPTRMLARQSLTASRAMDDT
LPVIGGANGTVNSLAGRPVLVCSPLHTCIIELPEGVKPVTTVGISKSEWNVQQALVGKQP
EIFLSPKFKGLHQNIVVAATDQGRPINYEIRLVSDAVRYIPALKIEDSGGEVRSWKTDLQ
SADNAPTDQSAAGHKGNVLPLPNIRLNHLNLRWSIHCGGGGWFSSSDCKPIRPLRVYDDG
THTFIDMPQGLASHGGFPVLQARNASGHLIGVDTQIRGNTYVVDSVPADILLRLGSEMVT
IQKEGK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaagacattgctttctttggggcttgccgtccttcctggattggcgctggca
ggcgtggatactggactccctgcggtgaacccgatcagttcgctgcagggaaaaccgcca
atacagcctgcagggacgaaaaccggttcggcccatccgtccacgacaccatccgcatct
ggcggcaccacgtctgcgggccagaaagtcccggccatctccccggaggctgccgcgcgg
atggcaacggcgcatgtgtggcaacagtccatagcgactccgccagaggggccagagagt
gccccaaccaggatgctggcccgtcagtcgctgacggcgtcacgggcgatggacgacacc
cttccggtgatcggcggcgcgaacgggaccgtcaacagccttgccggtcgccccgtgctg
gtctgttcaccgctgcacacctgcatcatcgagctgcccgagggcgtcaagcccgtgacg
accgtcgggatcagcaagtcggaatggaatgtgcaacaggcgctggttgggaaacagccg
gaaatctttctgagcccgaaattcaagggtctccaccaaaacatcgtggtggccgcgacc
gaccagggcaggcccatcaactatgaaatccgtctggtcagtgacgcagtgcgctacatt
cccgccctgaagatcgaggatagcgggggcgaggtccgttcctggaaaacagacttgcag
tcagcagacaacgcaccaacggatcagtcggctgccggccataaaggcaatgtactgcct
ctgcccaatatccgtctcaaccacctcaatcttcgctggtccattcattgcggtggcggt
ggatggttcagttccagcgattgcaaaccgatccgtccattgcgcgtgtatgacgatggg
acccataccttcatcgacatgccccaggggctggcgagccacggaggattccccgtcctg
caagcccgcaatgccagtggacacctgatcggagtcgatacccagatccggggcaacacc
tatgtcgtcgattcagttcctgccgatatcctgttacggctgggttctgagatggtcacc
atccagaaggaggggaagtag

DBGET integrated database retrieval system