KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_0527Help
Entry
Lferr_0527        CDS       T00758                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase/phosphopantothenate/cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe00770  Pantothenate and CoA biosynthesis
afe01100  Metabolic pathways
Module
afe_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:afe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Lferr_0527
Enzymes [BR:afe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     Lferr_0527
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     Lferr_0527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein DUF498 ABC_sub_bind
Motif
Other DBs
NCBI-ProteinID: ACH82781
Position
complement(485802..487058)
Genome map
AA seq 418 aa AA seqDB search
MTDNVFNTTEPLAGKRILLGVGGSIAAYKSPEIVRALRQAGVELRVVMTRSAAQFVTPLT
LQALSGEPVRGDLFAATEEAAMDHIRLARWADALLIAPISANGIARLAQGLADDLLGTIV
LASRVPLFLAPAMNSTMWMHPATQRNLAQIQADGAHLLGPDSGSLACGEDGAGRLLAPDR
LVGELRLALAEKTLRGQRVLITAGPTWEAIDPARGLSNRASGRQGFALSQACAEAGAEVL
LITGPTHEQTPPGVSRLDVLSARDMLTACLQALDRPTDIFIANAAVADHRPSHFSAQKLS
KTAIANPLPLSINPDIVSAVHRDSRRPRYIVAFAAETHDHLATAGTKAQRKGADVIVVND
INSAELGMGAAENACSILQGERVLHIPRCSKIDLARHLVRHLSSFISLPGTEIEDLHE
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgactgataacgtattcaacacgacggagcccctcgctggcaaacggattcttctgggc
gtgggcggcagtattgccgcctacaaaagcccggaaatcgtgcgcgccctgcgccaggcc
ggtgtagagttgcgtgtagtcatgacacgcagcgcagcacagtttgtgaccccgctgacc
ttgcaggccctgagcggcgagcccgtgcgtggagatctctttgccgccaccgaagaggcg
gccatggaccatatccgtctggcccgctgggcggacgccctcctgatcgcgcccatctcc
gccaatggaatcgcccgtctcgctcaaggtctggcggacgacctcctcggcaccattgtt
ctcgccagtcgtgtgccgctttttctcgcacccgcgatgaacagtaccatgtggatgcac
cccgcgacgcaacgtaaccttgcgcagatccaggcggatggcgcccacttgctgggcccc
gacagcggcagtctcgcgtgcggcgaggacggcgctggacgattgttggcgcccgaccga
ctggtgggcgaactacgtctagcgctggccgagaaaaccctgcgcggccaacgcgtcctc
attaccgccggtccgacttgggaggccatcgatccggcaagaggcctcagcaaccgggct
agtggccgccagggcttcgccctctctcaggcctgcgcagaagcgggagcggaggtgcta
ttgattaccggacccacccatgaacaaaccccgccgggagtaagccgtctggatgtcctc
tccgcaagggatatgctcacggcctgcctgcaggctctggaccgaccgacggatatattt
atcgccaacgccgccgtggccgaccacagaccgagtcacttcagcgcccaaaagctcagc
aaaaccgccattgccaatccccttcccctcagcatcaatccggatatcgtcagtgccgta
catcgggattcccggcgaccacgctatatcgtcgccttcgcagccgagacccatgatcac
cttgccaccgcgggtaccaaggcgcagcgcaagggcgcggacgtcatagtggtcaatgat
atcaactctgccgagctggggatgggggccgccgaaaatgcctgcagcatcctgcagggt
gaacgggtgctgcacatcccgcgctgcagcaaaatcgatctggcgcgccacctggtgcgt
cacctcagcagttttatctcattgcctggaacggagattgaagaccttcatgaataa

DBGET integrated database retrieval system