KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1334
Entry
Lferr_1334        CDS       T00758                                 
Name
(GenBank) P-type conjugative transfer ATPase TrbB
  KO
K20527  type IV secretion system protein TrbB [EC:7.4.2.8]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:afe00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Lferr_1334
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:afe02044]
    Lferr_1334
Enzymes [BR:afe01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Lferr_1334
Secretion system [BR:afe02044]
 Type IV secretion system
  Trb secretion system protein
   Lferr_1334
SSDB
Motif
Pfam: T2SSE DEAD Zeta_toxin AAA_16 DUF87 FtsK_SpoIIIE NACHT AAA_19 TrwB_AAD_bind AAA_28 AAA_29 DUF2075 ResIII AAA_18 ATPase Sigma54_activat RsgA_GTPase AAA_7 AAA_22 AAA_23 RNA_helicase MMR_HSR1 UvrD-helicase Sigma54_activ_2 TsaE ABC_tran cobW AAA_30 PduV-EutP AAA Mg_chelatase P-loop_TraG IstB_IS21 AAA_24 TIP49
Other DBs
NCBI-ProteinID: ACH83568
Position
1288233..1289201
AA seq 322 aa
MNIHAHDQQEQQAHARRIEQMRRILGPEIAALFDDTGVVEIMANPDGRVFVERLGSGISP
LGEIDASRVQSLLGLMADYLHTTVSRDRPIVEGAMPIEFLRSRFAGAIPPMVEGASFSIR
LPARSVYTLDQYVEAGIITAAQMDTLSDAVLSRKNILVSGGTGSGKTTLANALIDRISKL
SDIGTRIVIIEDTRELQCTAPNVIQFLTDDDAGIDMTRLLKLTLRYRPDRILVGEVRDKA
ALALLKAWNTGHPGGIATLHANNPEAALLRLDQLCQEAGVPAQQTLIHEAVDIVLQIARD
PNHPAGRRISAILNVKDGVLIS
NT seq 969 nt   +upstreamnt  +downstreamnt
gtgaatatccacgcgcacgatcagcaggaacagcaggcccatgcccgccggatcgagcag
atgcggcgcattctggggccggagatcgccgccctcttcgatgacactggcgtcgtcgag
atcatggccaaccccgacggacgggtctttgtcgagcgtctggggtcgggaatatccccc
ctgggcgagatcgatgcgagccgtgtccagtcgctgttagggctcatggccgactacctg
cataccacggtgagccgtgaccggcccatcgtcgagggggccatgcccatcgagttcctg
cgcagccgctttgccggcgcgattccgcccatggtggagggcgcgtctttcagtatccgc
ctcccggcccgttcggtgtacacactcgatcagtacgttgaggcgggcatcatcacggcg
gcgcagatggacaccctctccgatgccgtgctctcccgcaagaatatcctggtgagcggt
ggcacaggatccggcaagaccaccctggccaacgccctcatcgaccggatctccaaacta
tccgatatcggcacccgcatcgtgattatcgaagatacccgggagctccaatgcaccgct
cccaatgtgatccagttcctgaccgacgatgatgcgggcatcgacatgacgcgcctctta
aagctcacgttgcgctatcggcccgaccgcatactggtgggcgaggtccgcgacaaggcg
gccctggcgctgctcaaagcctggaatacggggcacccgggcggcatcgccaccctgcac
gccaacaaccccgaagcggccttgttgcgtttggaccagctctgccaggaagcgggtgtt
cccgcgcagcagacgctgatccatgaggcggtggatatcgttttgcagattgcccgtgac
ccgaatcatcctgctggtcgcaggatttcggccatcctcaatgtgaaagacggcgtgctg
atctcgtga

DBGET integrated database retrieval system