KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1337
Entry
Lferr_1337        CDS       T00758                                 
Name
(GenBank) Conjugal transfer protein TrbC
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB
Motif
Pfam: TrbC
Other DBs
NCBI-ProteinID: ACH83571
Position
1290594..1290980
AA seq 128 aa
MKKRLKAIFSGVRKVSAAGLMVLAPGMAFASTSGGVFSPIAGPLNTVLTGMQDLGGLVAA
GGFVATGLSWWHGGEHKKAMMIGMGATVGGIAMANAKSLATSITGGATMGHVGILGLAAS
HALHVVGL
NT seq 387 nt   +upstreamnt  +downstreamnt
atgaaaaagcggttgaaggcaatattctccggggttcgcaaggtcagcgccgcgggcctc
atggtcctggcccccggcatggcgttcgcgtccacatccggcggtgtgttttctcccatt
gcggggccgctgaatacggtcctgacgggtatgcaggatttgggcgggctggtcgccgct
ggcggcttcgtcgcgacgggactttcctggtggcatggcggcgaacacaaaaaggccatg
atgattggcatgggtgcgacggtcgggggcattgccatggccaatgcgaaatcgctcgcc
accagcatcaccggcggcgccacgatgggccatgtgggcatcctgggcctcgccgcatca
cacgcgctgcacgtcgtggggctctag

DBGET integrated database retrieval system