KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1338
Entry
Lferr_1338        CDS       T00758                                 
Name
(GenBank) hypothetical protein
  KO
K20529  type IV secretion system protein TrbD
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:afe00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Lferr_1338
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:afe02044]
    Lferr_1338
Secretion system [BR:afe02044]
 Type IV secretion system
  Trb secretion system protein
   Lferr_1338
SSDB
Motif
Pfam: VirB3
Other DBs
NCBI-ProteinID: ACH83572
Position
1290984..1291361
AA seq 125 aa
MAAEHTRRLPLHPSLTKPMLVAGGEREATFALWFVCLSIPVLVSLWFIPVGLIVGGVGQS
FLRTLAKHDPQSFGVVRRHWSQQSVYLGGASAYAPVQYKAPKEQTQSAASGGVLKALANL
MRKKK
NT seq 378 nt   +upstreamnt  +downstreamnt
atggcggcggagcatacccgccgtctcccgctccacccctccctgaccaagcccatgctc
gtcgcggggggtgagcgggaggccacatttgccctttggttcgtctgtctctctataccg
gttctggtctctctctggttcatcccggtgggtctcatcgtcggcggagtggggcagtcg
tttctgcgaacactcgcaaaacacgacccgcaatcctttggcgtcgtgcgtcgccactgg
agccagcaatccgtctacctgggcggggccagcgcttatgcgccagtccaatacaaggcc
cctaaagaacagacgcaaagtgccgcgtccggtggcgtgctcaaggccttggcaaacctc
atgaggaagaagaaataa

DBGET integrated database retrieval system