KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1339
Entry
Lferr_1339        CDS       T00758                                 
Name
(GenBank) CagE TrbE VirB component of type IV transporter system
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:afe00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Lferr_1339
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:afe02044]
    Lferr_1339
Enzymes [BR:afe01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Lferr_1339
Secretion system [BR:afe02044]
 Type IV secretion system
  Trb secretion system protein
   Lferr_1339
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_10 DUF87 AAA_29 ABC_tran AAA_16 Zot CbiA
Other DBs
NCBI-ProteinID: ACH83573
Position
1291361..1293883
AA seq 840 aa
MRSLKQYRDKALGLPDLLNIAFLVDGWQTDAGEMAIALQKDGSFLAGFRYDGPDLESQST
QDLEALSATWNNAIARLGTDWGVHVTAIREPADGYIDESECAFRDPVSRLIEAERRAQFG
SETHHYVSRYYLTVAWRTPIDAEVQLVQSMIQKKAGKQPGQLADAAFRDTLARYRQVIEV
ILGIFRHGYRVKAMDADALLTHIHECLTGATHRVNAPRIPAYLDALIGHHDFVGGLEPSM
DGEEIRVVTVLGYPSMTFPEMLENLHSLPIPLRYTLRFLPLDPPDAVADMAKIRDRWFGS
RANMKSLLTEKMTGEAQGQLSADDTVVNLAYDAKQAVNEAREGAVKFGNFTLSVVLRSAD
EKVLADRIKAIKTFLDNAGYVAHLETTNTVEAFLGSLPGHLYENIRRPLMHSLNVADFAP
KTEIWAGEARCPSPLMNLSDGRKAPPLLYAATTGNTPFRLNLHVGDLGHSLIAGMTGGGK
STLLALLAAQWQRYPDSRVIAFDKGMSLYALTEAMGGQHYDLNGPTSDLFFAPLQHVDDP
AEAAFAADWVEALATLQGMTITSTERSAIRDAVHGLARESGRSLTALLQMIQNRGIKDAL
QYYTLTGQTGKLLDAESDGLSMADASMITFEMSHLMNGGPAEHRVTVPVLLYLFHRIEQM
LDGRPTLILLDEAWTFLDNELFLAKLRQWLKELRKKNAAVVFATQSLNDLKNSSLLPVLK
ESCPTKIFLPNRAATSPDLKPLYIDMGLNDRQIELVVASTPKQDYYLSTPEGQRRIQFGM
GPVTLAFCGVSDPREVKRVAELKTQHGDRWPIAWLKERLSPSIRDGWVSYAESLYQGERA
NT seq 2523 nt   +upstreamnt  +downstreamnt
atgcgctccctgaaacagtaccgcgataaggccctgggccttcccgatctcttgaacatc
gcttttctggtggatggctggcagacggatgccggggaaatggccatcgcgctgcaaaaa
gacgggagctttctggcggggttccgctatgacgggcctgatctcgagagccagtccacg
caggatctggaggcgctctcggccacctggaacaacgccatcgctcgattgggcacagac
tggggtgtgcatgtcacggcgattcgcgagccggccgacggctatatcgacgaatcggag
tgcgcctttcgcgacccggtgtcgcgcctcatcgaggccgagaggcgggcgcagtttgga
tcggaaacccatcactatgtcagccgctattaccttacagttgcctggcgaacgcccatt
gatgcggaagtgcagttggtacagtccatgatccaaaagaaagccggtaaacaacccggg
cagctggccgatgcggcattccgggacacgctggcccgctaccggcaggtgattgaagtt
atcctgggcattttcaggcacggataccgggtgaaggccatggatgccgacgccctgctg
acccatatccatgagtgcctgaccggcgccacgcatcgcgtcaatgcgccccggattccg
gcgtatctggatgccctcatcgggcaccatgattttgtgggcggtctggagccgtccatg
gacggggaagagattcgcgtcgtaacggttctgggctatcccagcatgaccttccccgag
atgctggagaacctgcatagcctgcccattcccctacgctacacgctccgcttcctgccc
cttgatccgccggatgcggtggcggacatggcgaagatccgggatcgctggtttggctcc
cgggccaacatgaaatccctgcttacggagaagatgacgggcgaagcccagggacagttg
tccgccgacgatacggtggtgaacctcgcctatgacgccaagcaggccgtcaatgaggcg
cgggagggcgctgtgaagtttggcaacttcacgctatccgtcgtgctgcgttccgccgat
gaaaaagtgctcgcggaccggatcaaggcgatcaagaccttcttggacaatgcgggctat
gtcgcccacctggaaacgaccaatacggtggaagcgttcctgggcagcctcccgggtcat
ctctatgagaacatccgccggccactgatgcactcgctgaatgttgcggatttcgcgccc
aagacggaaatctgggccggtgaagcgcgttgcccgagtccgctgatgaatttgtctgac
ggccgcaaagctccgcccctgctgtacgcggcgaccacgggaaatacgcccttccgactg
aatctccatgtcggcgatctggggcacagcctgattgccggcatgaccgggggcggaaag
agtacgctcctggccctgttggccgcgcaatggcaacgttatcccgacagccgggtgatt
gccttcgacaagggcatgagtctctacgccctcacggaagccatgggtgggcagcattat
gatctgaacggcccgacctccgatctgttttttgcacccctgcagcacgtcgatgatccg
gccgaggcggcttttgcggccgactgggtggaagcgttggccaccttgcagggcatgacg
atcacctctacggagcgttcggccattcgtgacgctgtgcatggcctggcccgggaatcc
gggcgctcgctcacggcgctgcttcagatgatccagaaccgggggatcaaggatgccctg
cagtattacaccctgaccgggcaaacggggaagctgcttgatgccgagagtgacgggctg
tcgatggccgatgcgagcatgatcactttcgagatgagtcacctgatgaacggcggcccg
gcggagcaccgggtaacggttccggtactgctgtatctgttccaccggatcgaacagatg
ctggatgggcgacccaccctcattctgctcgatgaggcctggacctttctggacaacgag
ctgtttctggcgaagttgcgtcaatggctgaaggaactgcggaagaaaaacgccgccgtc
gtttttgccacacagtccctgaatgatctcaagaacagctccttgctcccggtcctgaag
gagtcctgcccgacgaaaatcttcctgcccaaccgggctgccaccagtccggacctcaag
cccctgtacatcgacatggggctgaatgatcggcaaatcgagctggtggtggcgtccacg
ccgaagcaggactactacctgtccaccccagaggggcagcgccggattcagtttggcatg
ggtccggtcaccctggctttttgcggtgtctccgatccgcgtgaggtcaagagggtagcg
gagctcaagacgcagcacggcgatcgctggccgatcgcctggctgaaagagcggctgtca
cccagcatccgggatgggtgggtgagctatgcggagtccctttaccagggagaacgggca
tga

DBGET integrated database retrieval system