KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1343
Entry
Lferr_1343        CDS       T00758                                 
Name
(GenBank) P-type conjugative transfer protein TrbL
  KO
K07344  type IV secretion system protein TrbL
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:afe00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Lferr_1343
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:afe02044]
    Lferr_1343
Secretion system [BR:afe02044]
 Type IV secretion system
  Trb secretion system protein
   Lferr_1343
SSDB
Motif
Pfam: TrbL
Other DBs
NCBI-ProteinID: ACH83577
Position
1295239..1297008
AA seq 589 aa
MRGHRRFPWIMGMLLGAVPGISFAAGSGSLSQVQSLLRGKILPWQSVMQTAATDLFYVLA
AVEFSVLFLNHVLQKRGHEDLFAGIIKKVVTLGFFLTLLDNSGTWIPDIINGLAGGAHAL
GVTAVTPGQIATEALQAFLGIVLSPIAAATHNLGNTFSDIFSGNFSAAFSSAGKAVASSN
PASLLVETLLAGIIGLLAGVGILVMALEFLMVQIESYLVIALGVIMLAGGGLRWTAKYVG
SYFDYAINVGVRLFILTALAYLVTYSIVPLIQTILENVTNPLQAGFEVLILGALIALLPR
KASSIASSLLSGNSSFSGGELAKEGGMIAGGTVALGAAGVGLAAAAGGGLAAGGLSAAAG
AGGGAAGGAGSLAGGLTGAAGAGETGAAAGVAAPEAGAMSASGGASSGAGAGNAVLAPGM
GGSAGSEAPQAARAVQAPAPITQSTGQQNPSKGVEAPSQETVKEAGQDKRNDQEMSASEP
FAGGEPQPDAPPVPVNAVPAPEPVSAPSGGGGQGSTAAPAPGAAVSGGATMDDVVEQLKQ
MQGQPKGVADRIKKGFAGRFLKHVEEITTAKSNQVQKNAIDSSHPRDFD
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgcgtggacaccgcaggtttccgtggatcatgggcatgcttctgggtgccgtccccggc
atttcgttcgcagcgggttcggggtcgttgagtcaggtacaaagccttttgcgaggcaaa
attcttccctggcaaagtgtcatgcaaacggcggccacggatctgttctacgtcctggcg
gcggtcgagttctccgtcctgtttctgaaccatgttctgcaaaagcgcgggcatgaggat
ctctttgccggtatcatcaagaaggtggtgacgctggggttttttctgaccctgctcgac
aactccgggacctggattcccgacatcatcaatggtctggccggtggagcgcacgcgctc
ggagtgacggccgtgacacccgggcagatcgcgacggaggctcttcaggcatttctcggg
atcgtgctgtctccaatagctgccgccacccacaacctgggcaataccttcagcgacatt
ttcagtggtaacttctccgcggctttttcttctgcgggcaaagcggtcgccagcagcaat
ccggcatcgctcctggtagagaccctcctggcggggatcattggcctgctggcaggcgtg
ggcattctggtcatggccctggagttcctgatggtccagatcgagagttacctggtgatt
gccctgggcgtgatcatgctggccggcggcgggctgcgctggacggcaaagtatgtcggc
agttatttcgattacgccatcaacgtgggtgtccgtctttttatcctgaccgcgctggcg
tatctggtgacctacagcatcgtgccgctgatccagacgatcctggagaatgtcacgaat
cctttgcaggctggattcgaggtgcttattctgggtgccctcatcgccctgttgccccgc
aaggcctccagcattgccagtagcctcctgtccggtaactcatccttctccggcggagaa
ctggccaaggaaggcgggatgatcgctggtggtacggtagcactgggagcggctggcgtg
ggcctggccgccgctgcgggcggggggcttgccgctggtggactctccgcggcggcgggt
gctggaggcggtgctgccggaggggctggcagtcttgcaggcggccttaccggggcggcg
ggcgcgggagaaaccggcgcggcggctggtgtggcggcaccggaagctggggcgatgtcc
gcaagcggtggcgcgagttccggcgcgggcgcagggaacgccgtactggcccccggcatg
ggtggttcggcgggtagtgaggctccacaggcagccagggctgtgcaggctccagcgccc
attacgcaatccactggccagcaaaacccatccaagggtgtcgaggcgccgagccaggaa
actgtaaaggaagcgggccaggataagcggaacgatcaggaaatgagtgcaagcgaaccc
ttcgcagggggcgaaccccagcccgacgcgccgcccgtcccggtcaatgcggttccggcg
ccagaacccgtcagcgcgccttccggcggtggcggtcagggaagcacggcggctccggct
ccgggtgcggccgtgagtggcggtgccacgatggacgatgtggtcgagcagctgaaacag
atgcaggggcagcccaagggagtggcggataggatcaaaaaaggttttgccggtagattt
ctaaaacatgtggaggaaataactacggcaaaatcaaatcaagtccagaagaacgccata
gattccagtcacccaagagattttgattga

DBGET integrated database retrieval system