KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1388Help
Entry
Lferr_1388        CDS       T00758                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe00630  Glyoxylate and dicarboxylate metabolism
afe00710  Carbon fixation in photosynthetic organisms
afe01100  Metabolic pathways
afe01120  Microbial metabolism in diverse environments
afe01200  Carbon metabolism
Module
afe_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:afe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Lferr_1388
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Lferr_1388
Enzymes [BR:afe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Lferr_1388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small MlaA
Motif
Other DBs
NCBI-ProteinID: ACH83621
UniProt: B5ERV0
Position
complement(1344053..1344385)
Genome map
AA seq 110 aa AA seqDB search
MADIQDYDSTPKYETFSYLPAMGPEKMRRQIAYLVNQGWNPGIEHVEPERASTYYWYMWK
LPMFGEQSVDTVIAELEACHRAHSNHHVRLIGYDNYSQSQGSAFVVFRGR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggctgacattcaagactacgactcaacacccaagtacgaaaccttctcctatttgccg
gcaatgggaccggaaaaaatgcgtcgtcagatcgcctatctcgtgaaccagggctggaac
cccggcatcgagcatgtggagcctgaacgcgcatcaacatactactggtacatgtggaaa
ctgcccatgttcggcgagcagtcagtggacaccgttattgccgaactggaggcatgccat
cgcgcccactccaaccatcacgtgcgcctgatcgggtatgacaactactcgcagagccag
ggcagcgcttttgtggtgttccgcgggcgataa

DBGET integrated database retrieval system