KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1392
Entry
Lferr_1392        CDS       T00758                                 
Name
(GenBank) conjugal transfer protein
  KO
K20531  type IV secretion system protein TrbF
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:afe00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Lferr_1392
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:afe02044]
    Lferr_1392
Secretion system [BR:afe02044]
 Type IV secretion system
  Trb secretion system protein
   Lferr_1392
SSDB
Motif
Pfam: VirB8 DUF4783
Other DBs
NCBI-ProteinID: ACH83625
Position
1348580..1349248
AA seq 222 aa
MSSNPDYLAARQEWLERYGSYIAQARNWRIAALSAIGIAALFGAGMVYEADRVHIVPYVV
EVDKLGKAVELAQAVRAGSFAQPVVQHIVSRFTWLAFTRSPDKHVQKHFIDESYHYIASS
AESSLDAFYAQHNPYAAYSNKTQGNTVTIQSAVPVGQVTGKGGSYIVDFLVKHYGPHGGV
DGEQNWQGTVTYATVPPSNNPNVLKGNPFGIYITHFAFSPQV
NT seq 669 nt   +upstreamnt  +downstreamnt
atgtcgagcaatcccgattatctggctgcccgccaggaatggcttgagcgctacggctcc
tacatcgcgcaggcgagaaactggcgcatcgctgccctgtcggctatcggcattgccgcc
ctgtttggggcgggcatggtgtacgaggcagaccgtgtccatatcgtgccctatgtcgtc
gaagtggacaaactgggcaaggctgtggaactggcgcaggccgtgcgggccggttctttc
gcccagccggtagtgcagcacatcgtttcccgcttcacctggctcgctttcacgcgcagc
ccggacaagcatgtgcagaagcacttcatcgatgaatcctatcattacatcgcatcgagc
gcggaatcctcgctggacgccttctacgcgcagcacaatccctacgcggcctattccaac
aagacgcagggcaacacggtcacgatccagagcgccgttcccgttgggcaggtgacgggc
aagggtggctcgtacatcgtcgatttcctggtaaagcactatggcccgcatggcggcgtg
gatggcgagcagaactggcaaggcacggtcacttacgcgacggtcccgccatcgaacaac
cccaatgtcctgaaaggcaatccattcggcatctacatcacgcactttgctttcagtccg
caggtgtaa

DBGET integrated database retrieval system