KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1393
Entry
Lferr_1393        CDS       T00758                                 
Name
(GenBank) Conjugal transfer protein TrbG/VirB9/CagX
  KO
K20532  type IV secretion system protein TrbG
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:afe00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Lferr_1393
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:afe02044]
    Lferr_1393
Secretion system [BR:afe02044]
 Type IV secretion system
  Trb secretion system protein
   Lferr_1393
SSDB
Motif
Pfam: CagX
Other DBs
NCBI-ProteinID: ACH83626
Position
1349261..1350376
AA seq 371 aa
MKTKTLLSLGLAVLPGLALAGVDTGLPAVNPISSLQGKPPIQPAGTKTGSAHPSTTPSAS
GGTTSAGQKVPAISPEAAARMATAHVWQQSIATPPEGPESAATRALARQSLTASQAMDDT
LPVIGGANGTVDSLAGRPVLVCSPLHTCIIELPEGVKPVTTVGVSKSEWNVQQALVGKQP
EIFLSPKFQGLHQNIVVAATDQGRPINYEIRLVSDAVRYIPALKIEDSGGEVRSWKTDLQ
SADSRTADNAPTDQSAADHKGNVLPLPNIRLNHVNLRWSIHCGGGGWFRSSDCKPIRPLR
VYDDGTHTFIDMPQGLASHGGFPILQARNASGHLIGVDTQIRGNTYVVDSVPAEILLRLG
SEVVTIHQEGK
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgaaaaccaagacattgctttctttggggcttgccgtccttcctggattggcgctggca
ggcgtggatactggactccctgcggtgaacccgatcagttcgctgcagggaaaaccacca
atacagcctgcagggacgaaaaccggttccgcccatccgtccacgacaccatccgcatct
ggcggcaccacgtctgcgggccagaaagtcccggccatctccccggaggctgccgcgcgg
atggcaacggcgcatgtgtggcaacagtccatcgccaccccgcccgaaggcccagaaagt
gctgcaaccagagcgttggcacgtcagtcgctgacggcgtcccaggcgatggacgacacc
cttccggtgatcggcggcgcgaacggaaccgtcgacagcttggccggtcggcccgtgctg
gtttgctcgccgctgcacacctgcatcatcgagctgcccgagggcgtcaagcccgtgacg
accgtcggcgtcagcaagtcggaatggaatgtgcagcaggcgctggtggggaaacagccg
gaaatcttcctgagcccgaaattccagggtctccaccaaaacatcgtggtagccgcaacc
gaccagggcaggcccatcaactatgaaatccgtctggtcagtgacgcggtacgctacatt
cccgccctgaagatcgaggatagcgggggcgaggtccgttcctggaaaacagacttgcag
tcagcagactcgcggacggcagacaacgcaccaacggatcagtcggctgccgaccataaa
ggcaatgtactgcctctgcccaatatccgtctcaaccacgtcaatcttcgctggtccatt
cattgcggtggcggcggatggttccgttccagcgactgcaaaccgatccgtccattgcgc
gtgtatgacgatgggacccataccttcatcgacatgccccaggggctggcgagccatggg
ggctttcccatcctgcaagcccgcaatgccagcggacacctgatcggagtcgatacccag
atccggggcaacacctatgtcgtcgattcagttcctgccgagatcctgttacggctgggt
tctgaggtggtcaccatccatcaggaggggaagtaa

DBGET integrated database retrieval system