KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1395
Entry
Lferr_1395        CDS       T00758                                 
Name
(GenBank) conjugation TrbI family protein
  KO
K20533  type IV secretion system protein TrbI
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:afe00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Lferr_1395
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:afe02044]
    Lferr_1395
Secretion system [BR:afe02044]
 Type IV secretion system
  Trb secretion system protein
   Lferr_1395
SSDB
Motif
Pfam: TrbI DUF4689
Other DBs
NCBI-ProteinID: ACH83628
Position
1351397..1352857
AA seq 486 aa
MKSGKDFFSDLLQKKKGLLPAGQQPAGDSRKGPGGQQDPCGQPGPSRPQGPQVSQPGIEV
KPDRDRMATRIKRTPLYIAAAVVGLGAYGGYEYLQSHPMFGNAKPQVQAKTIQPASGTGA
PVAPAHRKQVHKPTVPGGASDTSATAATNSDADQSHPAKAPASTVPKKNPYATQDAAFAS
ALGTGSAGSGAGEGLAWKTPESTPSAQTPTVLPTALPGASLPGASLPDAEPSAAKKTKKK
TPPSLVTRETSPYEILSGSVIPAVLQTGIKSYLPGEITAVVSQNVYSSVNGATLLIPAGA
KLVGTYDTQTALGINRLAVAWTRIEFPNGTTMNLPGYEGAGGAGYAGFAGEVNDHTWLIF
KNALLMSIVDAGMAIASPSTSTSVTGQMSGNVALQDSEQALAQTFGEAESQLLEKYIDIA
PTITIPTGYLFSVVVAHDMVFPGPYDPAMQTGSAMVDQALGPNLNPYGLRPAKGLRPAKG
LHPAKG
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgaaaagcggcaaagactttttctccgatttgctccagaaaaagaaagggctgctcccg
gcagggcaacagcccgccggggatagccgcaaaggccctggcgggcagcaagacccttgc
gggcagccaggccctagcaggccgcaaggcccacaagtcagtcagcccgggatcgaggtc
aagccggacagggaccggatggcgacgcgcatcaagcggacgccgctctatattgcggct
gcggtggtcggactgggcgcctatggcggctatgagtatctgcaaagtcacccgatgttc
gggaacgccaagccgcaggtgcaggccaaaactatccagccggcgagcgggactggcgca
ccggtcgcccctgcgcaccggaagcaggtccacaagcccaccgtgcctggaggggcgtcg
gacacgtcggcaaccgcggccacgaacagtgatgctgaccagtctcatccagcgaaggct
ccagcgtccacagtgcccaaaaagaatccctacgcaacgcaggacgccgccttcgcgtcc
gccctgggtacgggaagcgccgggagcggggccggtgagggccttgcctggaaaacgccg
gagtcaacgccatccgcacagactccgacagttctccctacggccctgccgggtgcatcc
ctgccgggagcatccctgccggacgcggaaccgtcggcagcgaagaaaacaaagaagaag
accccgccgtccctggtgacccgggagacgagcccctacgagattctttccgggtcggtc
attcccgccgttttgcagacgggcatcaagagctatctgccgggagagatcacggcggtg
gtcagccagaacgtctattcgtccgtgaacggggcaacgctcctgatccctgccggcgcc
aaattggtgggcacctatgacacacagacggccctgggcatcaaccggctggccgttgcc
tggacgcgcatcgagtttccgaacggcaccaccatgaacctgccgggatacgaaggggca
ggtggtgctggatacgccggcttcgccggggaggtcaatgaccacacctggctgatcttc
aagaatgcgttattgatgtcgatcgtggatgccgggatggcgattgcttctccgtccaca
tcgaccagtgtgacaggccagatgtccgggaatgtggcgcttcaggacagcgagcaagcc
ctggcacagacctttggggaagccgaatcccagctgctggaaaagtacatcgacatcgca
cccacgatcaccattcccaccggctatctgttctcggtggtggtggcgcatgacatggtc
ttccccggcccctacgacccggccatgcagacgggatcggccatggtcgaccaggcgctt
gggccgaatctcaatccctatgggttacgccctgccaaggggctgcgccctgccaagggg
ttgcaccctgcgaaggggtaa

DBGET integrated database retrieval system