KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1397
Entry
Lferr_1397        CDS       T00758                                 
Name
(GenBank) Lytic transglycosylase catalytic
  KO
K03194  type IV secretion system protein VirB1
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:afe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Lferr_1397
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:afe02044]
    Lferr_1397
Secretion system [BR:afe02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Lferr_1397
SSDB
Motif
Pfam: SLT
Other DBs
NCBI-ProteinID: ACH83630
Position
1353167..1353823
AA seq 218 aa
MILLSQINAECAPMVAPSTMAAIVRVESGGNPLAMWNNSTQSMVIPGSRAQAIRYLRHAM
AAGQRVDVGLAQVDTGNFAAFGLRPRNAFNACANLRAGGEILHMDWQQALSSGYRGQQAL
YHAFEAYNSGRLRGDAQYANRILGAAGVPTSAGCKLAGCKPAGRKPVAYGRLRTVSWGNQ
GNAALPSNPFPQFRWQAKSPQAVTSGPSDDSHSWPVLP
NT seq 657 nt   +upstreamnt  +downstreamnt
atgattttactctcccagattaacgcggaatgcgcccccatggtcgcaccctcgacgatg
gccgccattgtgcgggtggagtccgggggcaatccgttggcgatgtggaacaacagcacg
cagagcatggtcattcccggcagccgggctcaggccatccggtatttgcggcacgccatg
gccgcaggtcagcgggtcgacgtggggctggcccaggtggataccgggaacttcgccgcc
ttcggactcaggccccggaacgccttcaatgcctgcgccaaccttcgggctggcggcgag
atcctgcacatggattggcaacaggcgctgtccagcggctaccggggtcaacaagcgctc
tatcacgcctttgaagcgtacaactccgggcggctccggggcgatgcccaatatgccaac
cggatactgggtgccgctggagtacccacgtccgccggctgcaagcttgccggctgcaag
cctgccggccgcaagcctgtcgcttacggccgattgcgcaccgtctcctggggcaaccag
ggtaacgcggcactgccgagcaatccctttccccaatttcggtggcaggcaaaatcgcct
caggcggtaaccagcggaccatcagatgactcccactcctggccggttctcccataa

DBGET integrated database retrieval system