KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1551Help
Entry
Lferr_1551        CDS       T00758                                 

Definition
(GenBank) Polyphosphate kinase
  KO
K00937  polyphosphate kinase [EC:2.7.4.1]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe00190  Oxidative phosphorylation
afe03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Lferr_1551
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Lferr_1551
Enzymes [BR:afe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.1  polyphosphate kinase
     Lferr_1551
Messenger RNA biogenesis [BR:afe03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     Lferr_1551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP_kinase_C PP_kinase PP_kinase_N PLDc_2 DUF2120
Motif
Other DBs
NCBI-ProteinID: ACH83773
UniProt: B5EJ99
Position
complement(1508049..1510154)
Genome map
AA seq 701 aa AA seqDB search
MSEVPAPEKARSAPPLDSPELYFNRDLSILAFNQRVLALADDQRVPLLERLRYLTIVSSN
LDEFFEVRMAGLLQRLKFGAGPLGPDMLGPQREIEAVAKKAHEIISEQYRCLNQRLLPAL
AKEGIRLLRRREWRAAQKRWISNYFQTEVLPLLTPLSLDPAHPFPKVQNKGLNFAIVLEG
QDAYGRHSPIAIVQAPRILPRIIWIPQHLAGPNDFVFLSSVIHEHVQALFPGLTIQGFYQ
FRVTRNSELFVDEEEVDNLLDALADELPLRPFGEAVRLEVANNCPREVVEYLLKHFELSE
SNLYSLQGPVNLSRLAAIIEMVPRPDLLYPPFIPGLPAVCSHPENIFAHLREAPILLHHP
YQSFNPVLDFLRQAVSDPKVIGIKQTLYRTTPDSPVIDALIEAAMAGKQVTAVVELKARF
DEANNIRMAERLEEVGVQVVYGVVNHKVHAKMILILRREEDGIRLYGHLGTGNYHPRNAR
IYTDLSLLTANPDITADMNDLFMHITGMGKAPQLRCLLQSPFTMFQGIQEAIDTEIRHGS
KGRIIVRVNALVEPDLIRALYRASQAGVEIDLVVRGACALRPGIPGVSDHIRVRSIVGRF
LEHSRVYYFGNNGHPRLWISSADWMGRNLFRRLEVAVPITDPDLRARILTETLQLYLEDD
CNAWAMRADGDYEFLRNPLDANCKSAQDRLLEHYNRSSHYG
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaggtgcctgcgccggaaaaagcccgttccgcgccgcctctcgacagccctgag
ctgtacttcaaccgagacctcagcatcctcgccttcaaccagcgggtactggccctggct
gacgaccagcgcgtaccgctgctggaacgtttacgctacctgaccatcgtttccagcaat
ctggacgaattttttgaagtgcgcatggccggactgttgcagcggcttaaattcggcgcc
ggccccttgggaccggacatgcttgggccccaacgcgaaatcgaggcagtagcgaaaaag
gcccatgaaatcatttccgaacaataccgatgcctgaatcagcgcctgctgcccgctctg
gctaaggaaggtattcgcttgttgcgccgccgcgaatggcgggcagcgcagaaacgttgg
atcagcaattatttccagacggaggtgctgcctctgctcactcccctgagcctcgacccc
gcccacccctttcccaaggtacagaacaaagggctgaatttcgctatcgttctggaaggc
caggatgcttacgggcgacacagccccatcgccatcgtacaggcgccacgcattctcccc
cgcatcatctggattccgcaacatctggcgggtccgaatgatttcgtgtttctctcctcc
gtcatccacgaacatgtgcaggcgctctttccgggtctgaccatccagggtttttatcag
tttcgggtgacgcgcaacagtgaactctttgtggatgaggaagaggtggacaatctcctc
gacgcgctggccgatgaattaccgctacgcccctttggcgaggcggtacggctggaggtc
gctaacaattgtccgcgggaagtggtggaatatcttctgaaacattttgaactgagcgag
agcaacctgtattcattgcagggtcccgtgaatctgtcacggttggcggccatcatcgaa
atggtcccccgccccgacttgctttatccgcccttcataccggggctgccagcggtttgt
tcacaccccgagaacatattcgcgcatctacgggaggcgcccatcctgctccatcaccca
taccagagcttcaacccggttctggatttcctccgccaggcggtcagcgatccaaaagtc
atcggcatcaagcagacgctgtaccgtaccacccccgactccccggtcatcgacgcgttg
atagaagcggccatggccgggaaacaggtcacggcagtggtcgaactcaaggcccgcttt
gacgaagccaataacatccggatggccgagcgtctggaagaagtgggtgtgcaggtggta
tacggcgtggtcaatcacaaggtgcatgccaagatgattctcatcctgcgccgggaggag
gacgggatccgcctctacgggcacttgggtacgggcaattatcatccccgcaatgcgcgg
atttacactgatctcagcctgctcacggcaaatcccgacatcacggcggacatgaatgac
ctgttcatgcatatcactggcatgggcaaggcaccacaattgcgctgtctgctgcagagt
ccctttacgatgttccagggcatacaggaagccatcgatacggagatccgtcacggaagc
aaaggtcgcatcatcgtgcgggtgaacgcgctggtcgaacccgatctgattcgcgccctg
taccgggcctcccaggccggggtggaaatcgacctggtggtgcgcggcgcctgtgccctg
cgccccggcatcccaggtgtctccgatcatatccgggtacgttccattgtcggccgtttc
ctcgaacacagtcgcgtctattacttcggaaacaacgggcatccccgtctctggatatcg
agcgccgactggatgggacgcaatcttttccgccgtctggaagtcgcagtacccattacc
gaccccgacttgcgcgcccgcatactcacggaaacccttcagctatacttggaagacgac
tgtaacgcttgggcgatgcgtgcggatggtgattatgaatttttacgcaaccccctggat
gccaactgcaaatccgcacaggaccgtctgctggaacactacaacaggagcagtcattat
gggtga

DBGET integrated database retrieval system