KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1726Help
Entry
Lferr_1726        CDS       T00758                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe00260  Glycine, serine and threonine metabolism
afe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
afe01100  Metabolic pathways
afe01110  Biosynthesis of secondary metabolites
afe01130  Biosynthesis of antibiotics
afe01230  Biosynthesis of amino acids
Module
afe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lferr_1726
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Lferr_1726
Enzymes [BR:afe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Lferr_1726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ACH83948
UniProt: B5EK17
Position
complement(1699070..1699888)
Genome map
AA seq 272 aa AA seqDB search
MSRLAGLFVQLRDAGRAALIPFMTAGDPSLTATVPLMHALVAAGADAIELGMPFSDPMAD
GPSIQRASERALARGVKLRMVLEWVREFRTTNSHTPVILMGYLNPVEAMGITSFAEAAAT
AGVDGVILVDLTPEEGRGEAVVLRQRGIDPIFLLAPTSGPERVATVRSMGSGFVYYVSLR
GITGAAQADWAEVLERVQHLHRQLGLPVAIGFGIRDAATVARVATGADAVVVGSALVDQL
AACATDQEAIAAAIRFVEPLAQAVRSTERRGA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtctcgccgggctgtttgtccaactccgggatgcgggtcgcgccgccctcatt
cctttcatgacggcgggtgacccatccctgaccgcgaccgtgcccctgatgcacgcgctg
gtcgccgcgggggccgatgccatcgaactggggatgcccttttccgaccccatggccgat
ggtcccagcatccagcgcgccagtgagcgggcgctggcgcgaggggtgaagctgcgcatg
gtcctggagtgggtgcgcgaattccgcacgaccaacagtcacacgcccgtcattctcatg
ggttatctgaatccggtggaagccatgggtataacctcgttcgccgaggctgccgcgacg
gcgggggtggacggtgtcattctggtggatctgactccggaggaggggcgaggtgaagcc
gtcgttctccgccagcggggtatcgatcccattttcctgctggcgccgaccagcgggccg
gaacgcgtggcgaccgtccgcagtatgggcagtggttttgtatattatgtatctctgcgc
ggtattaccggtgcagcccaggcggactgggcggaagttctggagcgggtacagcacctg
caccggcaactgggcctgcccgtggccatcggttttggcattcgcgatgcagcgacggta
gcgcgggtggcgaccggggccgacgcggtggtcgtcggcagtgcactggtcgatcaactg
gcggcgtgtgcgacggatcaggaagccattgcggcggccatccgctttgtcgagccgctg
gcccaggccgtccggagtacggaaaggagaggcgcatga

DBGET integrated database retrieval system