KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2210Help
Entry
Lferr_2210        CDS       T00758                                 

Definition
(GenBank) glycyl-tRNA synthetase, beta subunit
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:afe00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Lferr_2210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:afe01007]
    Lferr_2210
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:afe03016]
    Lferr_2210
Enzymes [BR:afe01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     Lferr_2210
Amino acid related enzymes [BR:afe01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   Lferr_2210
Transfer RNA biogenesis [BR:afe03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Lferr_2210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: ACH84413
UniProt: B5EMS4
Position
2188108..2190192
Genome map
AA seq 694 aa AA seqDB search
MSAPEDLLLELGCEELPAREQMPLQDAATGIIGQLLDAAGLQFGSIHGYVTPRRLALWIK
DVSRQSLPQETLRRGPLVARARDAQGKPTAAAEGFARSCGVSLDDLLTLETEKGPVLAWR
EVGTAQDSHALLPEIASRLVTSLPLRKRMRWGAGSDSFLRPVRWLLLRQGGQVLDWKMFG
LDAGGESFGHRVHHPQAVRISTPAGYAGSLLQAKVMVDFAERRAHISGKMAALADEMAVT
PILPEALLDEITGLNEWPVVLAGSFAADYLRVPEEALITVMMQHQRYVPLRGRNERLVPH
YLFAANLHSRDTQVVIDGNNRVLRARLADAAFFWDQDRQISLQTRRAALAGVLFQDGLGS
ILDKTVRLQELAAALSPQFAVDAGDMNRAAALCKSDLLSGLVGEFPELQGIMGGHYARHD
GENNRVATAIAQHYLPSGRDDEIPADAHGQCLAIADKLDTLCGFFAIGKVPTGDRDPFAL
RRAALGVLRIVLDAGVPLNLDEAVTRTLAAYGGAFARNRTEIRSAILDFFQDRMRVYFRE
EGFRADQIAAVLSRQPHEPLDARQRLEALALFQAEHAAADALAALIKRINNLLRKEVISG
DWPIDPQYFMDPVENTLWDYWQALEQPLHAQLAERRYTAALGLLAGLRPAVDQFFDGVMV
LAEDPVLRQNRLALLARLQEAFLRIADFSQLQGA
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgcctgaagatctcctgctggaactgggttgtgaagagttgcccgcgcgggaa
caaatgcccctccaggacgccgcgaccgggatcataggccaactgctcgatgcggcagga
ttgcagtttgggagcattcatggctatgtcacgccgcgacggctcgctctctggatcaaa
gacgtctcccggcagagcctgccgcaggagaccctacgccgcggccccctcgtggcgcgc
gcccgtgatgcccagggcaagcccacggcggcggcggagggctttgcccgttcgtgtggg
gtcagcctggacgacctgctcaccctggagaccgaaaaaggccccgtcctggcctggcga
gaggtcggcacggcgcaggacagccatgcgctgttacccgagatcgccagcagactggtc
accagtctgcccctgcgcaaacgcatgcgctggggagctggttctgacagtttcctgcgt
ccggtacgttggcttttgctgcgtcagggcggtcaggtgctggactggaagatgttcggt
ctggatgccggcggcgagagcttcggacatcgcgtccatcatccccaggcggtgcggatc
agcacgcctgccggttacgccggatccctgctgcaggcaaaggtgatggtggatttcgcc
gagcgccgcgcgcacatttccggtaaaatggccgccctggcagacgaaatggccgtcact
ccgatcctgccggaggccttgctggacgagatcaccggactcaacgaatggccggtcgtt
ctcgctggcagcttcgccgcggactatctgcgggtgcccgaggaagcgctgattacggtc
atgatgcagcaccagcgttatgtccccctgcgcggtcggaatgagcgcctggtcccccat
tatctgttcgcggccaacctccacagccgggatacgcaggtcgtcatcgatggaaataac
cgggtactgcgtgcccgcctcgcggatgctgccttcttttgggatcaggatcgccagatc
tccctgcagacacgacgggccgcactcgccggggtgctgtttcaggacggcctcggcagc
attttggataagaccgtgcgtctgcaggagcttgccgcagccctctcaccgcagttcgcg
gtggatgcgggtgacatgaaccgcgccgcggcactctgcaaaagtgatctgctcagcggt
ttggtgggcgagtttccggaactgcaaggcatcatgggcggccactacgcccggcatgac
ggggaaaacaaccgtgttgccacagccatcgcccagcattacctgcccagtgggcgcgat
gacgaaatcccggcggatgcgcacggtcagtgcttggccatcgccgacaagctggatacc
ctctgcggtttttttgccatcggcaaagtacctaccggggaccgcgatccctttgccctg
cgccgcgcggcgctgggggtgctgcggatcgtgctggatgccggagtgcccctgaacctg
gatgaagcggtaacccgcacgctggccgcttatggtggtgccttcgccaggaatcggacg
gagattcggagcgcgatactcgacttttttcaggatcggatgcgggtctatttcagggag
gagggcttccgcgccgaccagatcgccgccgtgctcagccgccagccccacgagccactg
gacgcacgccagcgtctcgaagccctcgcccttttccaggcggagcatgcggcggcagat
gccctcgcagcgctgatcaaacggatcaacaatctgttacgcaaagaagtgatctccggc
gactggcccatagatccccaatactttatggacccggtagagaacacactctgggactac
tggcaggccctggagcagcccctccatgcgcagcttgcggaacgtcgctataccgcggcc
ctcgggctgctcgcaggcctgcgccccgctgtcgaccaattttttgatggggtcatggtc
ctggccgaagatccggtgctgcgccagaaccgcctggcgctgctggccaggcttcaggaa
gcgttcctgcgcattgccgacttctcgcagttgcagggggcctga

DBGET integrated database retrieval system