KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2359Help
Entry
Lferr_2359        CDS       T00758                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Brite
KEGG Orthology (KO) [BR:afe00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Lferr_2359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ACH84560
UniProt: B5ENR7
Position
2332222..2332605
Genome map
AA seq 127 aa AA seqDB search
MEDQPPTEIQISVETRYLPEQSSPEQEHFAFAYQITMQNNGPQTAQLLSRHWIITDAEGH
VQEVKGPGVVGEQPTLQPGQRFRYTSGSVLSTPVGSMHGTFEWVSDTGESFVVPIPAFRL
AAATVFH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggaagaccagccccccacagaaatccagatcagcgtcgagacccgctatctgccggag
cagtccagcccggagcaggagcacttcgccttcgcctatcagatcacgatgcagaataac
ggcccgcagacggcgcagcttctcagtcgtcactggatcattacggatgcggaaggtcat
gttcaagaggtcaaaggacccggcgtggttggagaacagcccacgctgcagcctggacaa
cgcttccgttacaccagcgggtccgtcctgtccacgcccgtaggcagcatgcacggtacc
ttcgagtgggtcagcgataccggcgaaagtttcgtggttcccatccccgcctttcgcctg
gcggcggcgaccgtcttccattga

DBGET integrated database retrieval system