KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2661Help
Entry
Lferr_2661        CDS       T00758                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe00630  Glyoxylate and dicarboxylate metabolism
afe00710  Carbon fixation in photosynthetic organisms
afe01100  Metabolic pathways
afe01120  Microbial metabolism in diverse environments
afe01200  Carbon metabolism
Module
afe_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:afe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Lferr_2661
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Lferr_2661
Enzymes [BR:afe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Lferr_2661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ACH84855
UniProt: B5EQF8
Position
2640716..2641072
Genome map
AA seq 118 aa AA seqDB search
MSEVQDYKSRLSDPASRKFETLSYLPALTAEQIRQQVAYIVSKGWNPAVEHTEPENAFGN
YWYMWKLPMFGETDVDTILKEAEACHKANPHNHVRIVGYDNFKQSQGTSLVVYRGKTV
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagtacaggattacaaatcccgtctctccgacccggcgagccggaagttcgag
acactgtcttacctgcccgccctgaccgcggagcagatccgtcaacaggttgcgtatatt
gtttccaagggctggaatccggcggtagaacataccgaaccggaaaacgccttcggcaac
tactggtatatgtggaagttgcccatgttcggcgaaacggacgtggacaccattctgaaa
gaagcggaagcctgccataaggcgaatccccataaccacgtccgtatcgtcggctatgat
aacttcaagcagtcccagggtacttccctggtagtctatcggggcaagaccgtataa

DBGET integrated database retrieval system