KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2663Help
Entry
Lferr_2663        CDS       T00758                                 

Definition
(GenBank) von Willebrand factor type A
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA VWA_2 VWA_CoxE
Motif
Other DBs
NCBI-ProteinID: ACH84857
UniProt: B5EQG0
Position
2642083..2644401
Genome map
AA seq 772 aa AA seqDB search
MKHLEDYAELLQAFGEGSQAILQSKWQEATRVFSPSGLDQYLDGAMGLRSLGKGDGLVSS
YLDAAPHIAREVGEDAVWELVGAVMKMASKTSGAVLEAVVSTSPTAANRLADPELFKSYL
GMLDRLLAQVPRALRPMLENIDQLFGYLTLGGLRRWALWGAHAHRTDFEAQIAYFSLKSP
EALAMLQQERKGTLFVDIQRRLRMYLRALWGRDFFLRPTSGDFEDREGYRPYIEGIFIHL
PDAYDDWEDIDGMTRYRAVAVHAAAHVAYMRKAISAEALTPEQMAVIGLFEDARVEALAM
RAFPGIRAIWLPFHTAVAGPVASMGHLFSRLARAIIDPDYVDDNAWVQEGRRVFMEAEAR
WDDPQLSWDLGVHLADRLRNQRVSYHARTDIPDILYRDDNRYIWEFEEIDWEHETTILPG
AQVRKYVNVMEMVNEVDTELAGDDAQEVWVLQSELFPYEDMGLSYNQMEGKEPVSDPFHY
PEWDYQIQASRPLWATVLERRPRLGDARVVREVLEKYKPVSSRLRYLIEALQPQGVQRLR
KQEDGDEIDVEAAVRALVDIRMGLAPDTRIHMRSLRKVRDLGVLVLMDLSESTNDKVRGS
EDSILQLTRDATSLLADAMNRIGDPFAIHGFHSDGRHDVAYYRFKDFDEAYSEEAMGRIA
GMTGKFSTRMGAALRHAGHHLRHQRQSRKLLLVITDGEPADIDVRDPQYLRHDARRAVED
LGRDGVITYCLSLDPHADEYVSRIFGARNYQVIDHVERLPERLPILYAGLTR
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatctcgaagattacgcagaactgctgcaggcttttggcgagggaagccaggcc
atcctgcagagcaaatggcaggaggccacccgggtcttcagtccgtcaggcctggatcag
tacctggacggtgccatggggttgcgatctctgggcaagggcgatggcttggtgagcagt
tatctggatgccgccccccacatcgcccgggaagtgggagaggatgccgtctgggaactg
gtgggtgccgtcatgaaaatggcgtccaaaaccagcggtgcggtactggaggcggtggtg
tccaccagtccgacagccgccaaccgcctggccgatccggagctcttcaaaagctatctc
ggcatgctggaccgcctgctcgcgcaagtgccccgcgcgctgcggcccatgctggaaaat
atcgaccagcttttcggctatttgacgctgggcggcttgcgccgctgggcactctggggc
gcacacgcccatcgtacggacttcgaagcgcaaatagcctacttttccctgaaaagtccg
gaagccctggccatgctgcaacaggagcgcaagggcacgttatttgtggatattcagcga
cgcctgcggatgtatctgcgtgcgctctgggggcgggattttttcctgcgccccaccagc
ggtgactttgaagatcgcgaagggtatcggccttatatcgaagggattttcatccacctt
cccgatgcctacgacgactgggaagatatcgatgggatgacccgctatcgcgccgtggcg
gtccacgccgcagcccacgtcgcctatatgcggaaggcgatttccgccgaagccctcaca
ccggagcaaatggccgtgatcggtctgtttgaagatgcccgggtggaagccttggcgatg
cgggcctttcccggcatccgcgccatctggctgccttttcatacggcggtggcggggcca
gtggccagcatgggacatctgttctcccgtctggcacgggccatcatcgatcccgactat
gtggatgacaatgcctgggtacaggaaggccgaagggtattcatggaggccgaagcccgc
tgggacgatccgcaactttcctgggatttgggggtacaccttgcggaccgtcttcgaaat
cagagagtcagttaccacgctcgcaccgacattcccgacatcctctaccgcgacgacaac
cgttacatctgggagtttgaggaaatcgactgggagcatgaaacgaccatcctgcccggt
gcccaggtgcgcaagtacgtaaacgtcatggaaatggtcaatgaggtggataccgagctg
gccggggatgatgcgcaggaagtctgggtactgcaatcagagttgttcccctatgaagat
atgggactgagctataaccagatggaaggcaaagagccagtctccgatccctttcattac
ccggaatgggattaccagattcaggccagtcgtccgctctgggcgacggtgctggagcgt
cgcccccgtctgggcgacgccagggtggtgcgggaagtgcttgagaaatacaagccggtc
tccagccgcctcagatacctgatagaagccttgcagcctcagggtgtgcaacggttgcgc
aagcaggaggacggcgacgaaatcgatgtggaggcggcggtgcgtgcgctggtggatatc
cgaatgggtctggcgccggatacccgtatccacatgcgtagcttgcgcaaggtgcgcgac
ctgggtgtgctggtattgatggatttgtccgagtcgaccaacgacaaggttcgcggttcg
gaagacagcattctgcaactcacccgcgacgccacctccctgctggccgatgccatgaac
cggattggtgatccttttgcgattcacggtttccattccgatggtcgtcatgatgtggcc
tattatcgcttcaaggattttgacgaggcctacagcgaggaggccatggggcgcattgcc
ggcatgacgggcaaattctcgacgcgcatgggtgcggcactaagacacgccgggcatcat
ctgcgccaccagcggcaaagcagaaaactgctcctggtgattaccgatggtgaaccggcg
gacatcgacgtgcgggatcctcagtatttgcgccacgatgccaggcgggccgtggaagac
ctgggaagagatggcgtgatcacctattgcctcagcctggatcctcatgccgatgaatac
gtatcgcggattttcggggcgcggaactatcaggtaatcgaccatgtcgagcgcctgccg
gagcgcctgcctatattatacgctgggctgacccgataa

DBGET integrated database retrieval system