KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2664Help
Entry
Lferr_2664        CDS       T00758                                 

Definition
(GenBank) diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s)
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EAL GGDEF GAF_2 PAS_9 GAF PAS_4 PAS_3
Motif
Other DBs
NCBI-ProteinID: ACH84858
UniProt: B5EQG1
Position
2644679..2647303
Genome map
AA seq 874 aa AA seqDB search
MKGYSSWHPSRRAATQATLRNSIGRLQRITDFSVLLSGANEVIAYTENETDLLRSLCELA
VRHTHLRLAWIGRPDSDGIFQNLAAAGAVRYLEGIRISTSAELPEGQGSAGQSWRDQKPV
YNASLPKNVRMNLWAQRAKAFGFGASASLPIYRGNTLWAILMVYHGKKNVFDADFRRIMT
DLAKNVSYGLDRLDIRRKERESNAFNEVLLNDQASGISVVRFPEQIVERVNTRMLTILGA
SSADELIGHPVWGIIHHEEVGEQVGQFALEVLSEGYATRRDVPYRRLDGQMVFTDISGQR
LDGSDGVQRILWTHVDVTERHRLMDELTQLSLSDPLTGLPNRRALDTELGKAMARADRHE
HLLSVVMIDLDGFKPVNDTCGHEAGDMVLRTIGQRLRKGLRGTDFVARLGGDEFVLLLEN
CTALEEIEVVMRKIGEMIRQPIELPDKSRAEIDLSAGICLYPFGDSHNPDALLRYADQAL
YESKNHKADRVHYWTLFGDSVPVRQNVIQTRLREGGLLVHYQPILDNRSHKIVGVEALAR
LRDKDGQILYPAEFLPLITVEDTTYLSRMVLTQALADLAELDTLGCSLWVSVNVAPESFD
DHFVPCMAGVIGASDIAPSRITLEILESSNFLEHNAALSVLHGVKELGVRLALDDVGSAY
SSLLRLKDLPIDEIKLDQGFIRSLEDRPQDLYFLASIRDLAIGLGVDLVVEGVETDDIAD
AVSVMDIKLLQGYGVARPMPMAQLREFLAQRPSYHRQHPTSLFGLYAKQICDQGTLKKMI
LSNPSLINSDELADAARCDMHHHMQRLGLAEDSPLFGLHWEVHGAIASLLKAPVAEGWEQ
VRQVQKAFEDGLLEAFQKAKTCRSPGSGLSSVPV
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atgaagggatattcttcatggcacccctcccgcagggcggcaacgcaggccaccctgcgg
aacagtatcgggcgcttgcagcggatcaccgatttcagcgtgcttctttccggcgccaat
gaagtcatcgcctatacggaaaacgaaacggatctgctgcgatccctctgcgaattggcc
gtccggcacacccatctgcggctggcgtggattggccggcccgatagtgatggcatcttc
caaaacctcgccgccgccggggcggtgcgctacctggaaggtatccgcatatccacatcc
gcggaacttcccgagggacaaggctccgcaggccagtcctggcgcgatcaaaaaccggtt
tacaatgcctcgctccccaaaaatgtccgcatgaacctctgggcgcaacgcgccaaagcc
tttgggttcggggcaagcgcatcgctgccgatttatcggggcaacacgctgtgggccatc
ttgatggtctatcacggcaagaaaaacgtcttcgatgccgacttccggagaataatgacg
gatctggccaaaaacgtcagttacggcctggatcgtttggacatccggcgaaaggagcgg
gaatcaaacgctttcaacgaagtgctgctgaacgaccaggcatccggcatcagcgtcgtg
cgttttccggaacagattgtcgagcgagtcaacacgcggatgctgacaatcctcggcgcg
tcttccgcggatgagctgatcggacatcccgtatgggggatcattcaccatgaggaagtc
ggtgagcaggttggccagtttgccctggaggttctcagcgaaggctacgcaacacgcagg
gatgtgccctatcgccgcctggatggacaaatggttttcacggatatttcaggccagcgc
ctggacggatcggatggtgtgcaacgtatcctctggactcatgtggatgtgacggagcgc
catcggctcatggatgaactcacgcagttgtcgctttccgacccactcaccggcctgccc
aatcgccgcgctctggatacagaactgggcaaggccatggcccgcgctgatcgtcatgaa
caccttttgagcgtcgtcatgatcgatctcgacggcttcaaaccagtcaacgacacctgt
ggccacgaagccggggatatggtgttgcggaccatcggccagcgtttacggaaaggattg
cgcggcacggacttcgtggcccgcctgggtggcgatgagttcgttctgctcctggagaac
tgcaccgccctggaggagatcgaagtggtcatgaggaagatcggggaaatgatccggcaa
cccatcgaactccccgacaagagcagggcggagatcgatctcagcgccggcatatgcctc
tatcctttcggcgattcccacaatcccgatgcgctgctccgctatgccgatcaagcactt
tacgagagcaaaaaccacaaggcggatcgcgtgcattactggaccctcttcggagattcg
gtaccagtgcggcagaacgtcatccagacacggttgcgggaaggtggattgctggtccat
taccagcccatactcgacaatcgctcccacaagatcgtgggtgtggaggctttggcgcgg
ctgcgggacaaggatgggcagatactctatccggcggagtttctgcctttgatcactgtc
gaggacaccacctatctcagcaggatggtgcttacccaggcgctggcggatctggccgag
ctggataccttgggatgctcgctctgggtgtccgtgaacgtagccccggagtccttcgat
gaccacttcgttccatgcatggcaggcgttatcggagccagcgatatcgcaccttcccgg
atcacgctggagatcctggagagcagcaacttcctggagcataacgccgcgttgtccgtt
cttcacggcgtcaaagaactgggcgttcgcctcgctctggatgatgtgggcagtgcgtat
tcctcactgctccgcctcaaggacttgcccattgatgaaatcaagctggatcagggattt
atccgctccctggaggatcggccccaggatttgtattttcttgcttccattcgggatttg
gccatcggcctgggagtggatctggtggtggaaggggtcgaaacagatgacattgcggat
gcagtctcggtcatggacattaaattactgcaaggctatggtgtcgccagacccatgccc
atggcgcagttacgggaatttctagcccaacgtccgtcctatcatcgacagcatccgacc
agcttgttcggactttatgccaaacagatctgcgaccagggaaccttgaaaaaaatgatc
ctcagcaatccgagcctgatcaatagcgatgaattggcggatgccgcccgttgcgacatg
catcaccatatgcagcgcctgggtctcgctgaagactctcccttatttgggcttcattgg
gaggtccatggtgccatcgcatcgttgttaaaggctccggtcgcggaaggctgggagcaa
gttcggcaggtgcaaaaggcatttgaggatggcttgctggaagctttccagaaagcaaag
acctgtcgatcaccaggcagtggtctatcttccgtcccggtttag

DBGET integrated database retrieval system