KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2665Help
Entry
Lferr_2665        CDS       T00758                                 

Definition
(GenBank) dihydroorotase, multifunctional complex type
  KO
K01465  dihydroorotase [EC:3.5.2.3]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe00240  Pyrimidine metabolism
afe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afe00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Lferr_2665
Enzymes [BR:afe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.3  dihydroorotase
     Lferr_2665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ACH84859
UniProt: B5EQG2
Position
complement(2647426..2648700)
Genome map
AA seq 424 aa AA seqDB search
MHRIIRNIRVMDPGDGFDAVTDLAIADGRIVARGPLPADFQAEEALDGTGLIACPGFVET
SFQGHTPGHGRDGDLASELRAAVAGGVTQVLLRPDTLPVADTPAVLQEQRAVAERLALAR
VHLAGALTTQLQGVALTEMAGLVESGAIVFSQAKKSVASAALLRLALSYAADLGQPVLLH
GEEPELAAHGVMHEGRLSIRLGLIGRPAAAEQIGVQRDIAIAALSGCPIHFPHLSTAAAV
AEVAAARQRGEPVTCGVSIHHLLLTEQDVGFFNLHAKILPPLRTAADRDALRRALAAGAI
TAISSDHCPWGVDREGKTFIQAPFGIAAVEWLLPLALRLVDEGVVNLMTILRLLSIGPAQ
ALGLTPPSLAVGAAADLCIFDPEPRFVVEPTQGWSRGRNLPYGQWELRGQVRYTLVAGRV
IFRG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcacagaatcatccgcaatattcgggtcatggacccgggcgacggctttgatgcggtt
accgatctggccatcgccgacggccgaattgtcgcgcgggggccgctgcccgcggacttt
caggccgaagaagcgttggacggtacgggcctgatcgcctgccccggatttgtcgagact
tcttttcagggacacacgcctggtcatggtcgggatggcgacctggccagcgaattgcgt
gcggcggtggcgggaggcgtgacgcaggttctactgcgcccggataccctgcctgtcgct
gatacgcctgccgttttgcaggagcagcgtgcggtagctgagcgcctggcgttggccagg
gtacatctggctggcgcccttactacccagcttcagggtgtggcgctgacggaaatggcg
ggcctggtggaatcgggcgccatcgtcttcagccaggcgaagaagtctgtagccagtgcg
gctttgttgcggctggcgctgagttacgcggcggatttgggccagcccgttctgctccat
ggcgaagaaccggaactggcggctcatggcgtgatgcacgaaggccgcctgagtattcgc
ctgggcctgattgggcgcccggcggcggcggagcagatcggcgtccagcgtgatatcgcc
attgcggcgctcagtggctgccccatccattttccgcatctcagtactgctgcggcggtt
gccgaagtggctgccgcccggcaacggggcgagccggtgacctgcggggtgagtatccac
cacctgctgctcaccgaacaggacgtcggatttttcaacctgcatgccaagatcctgccg
cctctgcgcactgccgcagatcgtgatgccttgcgccgcgccctggctgcgggcgcgata
accgccatcagtagtgatcactgcccctggggggtggaccgcgaaggcaagacctttatc
caggcgccattcggcatcgctgcggtggaatggctcctgcccctggcgctgcgactggta
gatgaaggagtggtgaacttgatgacaatcctgcgcctgctcagtatcggcccggcccag
gcgcttggtttgactccgccatccctggcggtcggtgccgccgccgacctctgtattttc
gacccggagccccgtttcgtggtggagccaacgcaggggtggagccggggccggaatctt
ccgtatgggcaatgggagttgcgcgggcaggtgcgctacaccctggtggcagggcgggta
atttttcgcggttga

DBGET integrated database retrieval system