KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2669Help
Entry
Lferr_2669        CDS       T00758                                 

Definition
(GenBank) protein of unknown function DUF179
  KO
K07735  putative transcriptional regulator
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Brite
KEGG Orthology (KO) [BR:afe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:afe03000]
    Lferr_2669
Transcription factors [BR:afe03000]
 Prokaryotic Type
  Other transcription factors
   Others
    Lferr_2669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF179 GYD
Motif
Other DBs
NCBI-ProteinID: ACH84863
UniProt: B5EQG6
Position
complement(2650613..2651170)
Genome map
AA seq 185 aa AA seqDB search
MTFSSLKNHLLIAMPALHDGVFDRTVIVVCEHNAEGAMGVVINRLVDINMSDALRAVDIQ
PSEEMIHRPVYWGGPIQPQHGFILHSPRGEWLSSLEVNDDLALTSSPDILQAIAQHEEPQ
RYLLALGYAGWGAQQLEAELQDNAWLHGPLDMAVIFDLPASERWQAAARLLGVDMRLLSG
AAGHA
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaccttttcttctctcaaaaatcatctgctcattgccatgcccgcgctgcacgacggc
gttttcgaccgtacggtgatcgtggtctgcgaacacaatgccgaaggcgccatgggcgtg
gttatcaaccggctggtggacatcaatatgtccgatgccctgcgtgcggtggacatccag
ccctctgaagaaatgatccatcgcccggtatactggggcgggccgatccagccgcagcat
ggatttattctgcattcgccgcggggcgaatggctttccagtctggaggtcaacgacgat
ctggcgctgaccagttcaccggatattctgcaggccatcgcccagcacgaagagccgcag
cgttacctcctggccctgggttatgccggctggggcgcgcagcaactggaagcggagctg
caggataacgcatggttgcacggccccttggatatggcggtgattttcgacctgcccgcc
agtgagcgctggcaggccgcagcgcgcttgctgggggtggatatgcgcctgctcagcggt
gcggcaggtcatgcctga

DBGET integrated database retrieval system