KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2672Help
Entry
Lferr_2672        CDS       T00758                                 

Definition
(GenBank) 2-methylcitrate synthase/citrate synthase II
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe00020  Citrate cycle (TCA cycle)
afe00630  Glyoxylate and dicarboxylate metabolism
afe01100  Metabolic pathways
afe01110  Biosynthesis of secondary metabolites
afe01120  Microbial metabolism in diverse environments
afe01130  Biosynthesis of antibiotics
afe01200  Carbon metabolism
afe01210  2-Oxocarboxylic acid metabolism
afe01230  Biosynthesis of amino acids
Module
afe_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Lferr_2672
   00630 Glyoxylate and dicarboxylate metabolism
    Lferr_2672
Enzymes [BR:afe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     Lferr_2672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_synt
Motif
Other DBs
NCBI-ProteinID: ACH84866
UniProt: B5EQG9
Position
complement(2653495..2654655)
Genome map
AA seq 386 aa AA seqDB search
MAEPNFAPGLEGVAATQSSISNIDGAAGLLSYRGFAIADLAAHSSFEEVALLLLDGVLPG
AADLERFDHGLRAHRQVKYNVREIMKFMPVTGHPMDMLHCAVASLGMFYPQQELSDAERG
NTLHLDAMAMRIIARMPTIVAMWEQMRFGNDPISPRPDLSHAANFLYMLSGREPDPAHTK
ILDSCLILHAEHTINASTFSVLVTGSTLTNPYHVIGGAIGTLAGPLHGGANQKVVEMLEE
ISSVQQVGAYLDRKMANKEKIWGFGHRIYKTRDPRAVILKGMMEDMASHGNLRHSSLFEI
AIEVERQATERLGPKGIHANVDFYSGVLYHEMGIKADLFTPIFAMARSAGWLAHWREQLA
DNRIFRPTQVYTGEQDRRYVPVAQRT
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaccgaactttgcgccaggtctggagggtgtggctgcaacccagtccagcatt
tccaacatcgatggcgctgccggcctgctgagttaccgtggttttgccattgcggatctt
gcggcgcacagcagtttcgaggaggtggcgctcttgctgctggatggtgtcctgcccggc
gccgcagatctggaacggttcgaccacggtctgcgtgcgcaccgccaagtcaaatataat
gtccgggaaatcatgaagttcatgcccgtgaccggacaccccatggatatgctgcactgt
gccgtggccagtctgggcatgttctacccgcagcaggagctttccgatgccgaacgcgga
aatacgctccatttggacgccatggcgatgcggattatcgcgcgcatgcccaccattgtc
gcgatgtgggagcagatgcgtttcggcaatgatcctatttcacctcgcccggatctcagc
catgcggccaactttctctatatgctgtcgggtcgcgaacctgatccggcccataccaaa
atcctcgactcctgcctgattctgcatgccgagcacaccatcaatgccagtaccttctcg
gtactggtgaccggatccaccctgaccaatccttaccatgtcatcgggggggcgatcgga
accctggccggcccgttgcatggtggtgccaatcagaaggtggtggaaatgctggaagaa
atcagctccgtccagcaggtgggtgcctatctcgacaggaagatggccaacaaggagaag
atctggggtttcgggcatcgcatctacaaaacccgcgatccgcgtgcagtgattctcaag
gggatgatggaggatatggccagtcatggaaatctgcggcatagcagcctctttgaaatt
gccatcgaagtggaacgccaggctacggagcggctcggtcccaaggggattcacgccaat
gtggatttctattcgggcgtgctgtatcacgagatgggcatcaaagcggacctttttacg
cctatttttgctatggctcgttctgcgggctggctggctcactggcgggagcaactggcg
gataaccggatcttccggcctacgcaggtgtatacaggggaacaggatcgacgctatgtg
cctgtggcccaacgtacttag

DBGET integrated database retrieval system