KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2675Help
Entry
Lferr_2675        CDS       T00758                                 

Definition
(GenBank) Transketolase central region
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe00010  Glycolysis / Gluconeogenesis
afe00020  Citrate cycle (TCA cycle)
afe00620  Pyruvate metabolism
afe01100  Metabolic pathways
afe01110  Biosynthesis of secondary metabolites
afe01120  Microbial metabolism in diverse environments
afe01130  Biosynthesis of antibiotics
afe01200  Carbon metabolism
Module
afe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:afe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lferr_2675
   00020 Citrate cycle (TCA cycle)
    Lferr_2675
   00620 Pyruvate metabolism
    Lferr_2675
Enzymes [BR:afe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Lferr_2675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ACH84869
UniProt: B5EQH2
Position
complement(2658359..2659339)
Genome map
AA seq 326 aa AA seqDB search
MAEMMYWQGILRAHDEEMARDPLVFAMGEDIGVAGGTYKATSGLFAKYGEQRVIDTPISE
NSYTGIGVGAAMIGARPIVEIMSVNFAWLAMDQLMNNAAKIHYMSGGRIRCPFVMRVPGG
TAHQLGAQHSARMEKVFMGISGLRVVTPATPRDAYGLLKSAVRCDDPVVIIEHESMYNLK
GEIPDEEFFTPLEGVEVMRPGKDVSIFAYNISVHWALDAAQKLAQDYGIDAEVVDLRALK
PMDRAGIAASVRKTHRAVVVEEDEAPVGVGSEVMAILNEECFFDLDAAPVRVHALDVPIP
YNRRLEKAAIPNAGEVVAAVRKMLGR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaatgatgtattggcagggaatcctgcgcgcccacgatgaagagatggcgcgg
gaccccctggtttttgccatgggtgaggatatcggcgtcgccggcggtacctacaaggcg
accagcggcctcttcgccaaatacggcgagcagcgggtaatcgatacacctatttccgaa
aacagctacaccggtatcggggtgggtgccgccatgatcggggcccgtcccatcgtcgaa
atcatgagcgtgaatttcgcctggttggcgatggatcagctcatgaacaatgccgcgaaa
atccattacatgtccggtgggcgtatccgttgtcccttcgtgatgcgggtaccgggcggc
actgcgcaccaattgggtgcccagcactcggcgcgtatggagaaagtgttcatgggtatt
tccggcctgcgggtggtgaccccggcaacgccgcgcgacgcctacgggttgctgaaaagc
gccgtgcgctgtgatgatccggtagtgatcatcgagcacgagagtatgtataacctcaag
ggcgagatcccggacgaagagttttttacgccgctggaaggcgtcgaagtgatgcggccg
ggtaaggacgtcagtatttttgcctataacatcagcgttcattgggcgttggatgcggcg
cagaagttggctcaggactacggcatcgacgccgaagtggtggatttgcgggcactcaaa
cccatggatcgggccggtatcgcggccagcgtacgcaagactcatcgcgccgtcgttgtc
gaagaagacgaggcgccggtgggcgtgggttccgaggtgatggcgatcctcaacgaggaa
tgctttttcgatctcgatgcggcgccggtacgggtgcatgcgctggatgtgcctattccg
tataatcgccgcctggaaaaggcggccatccccaatgccggagaagtggtcgccgctgtg
cggaagatgctgggccggtaa

DBGET integrated database retrieval system