KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2677Help
Entry
Lferr_2677        CDS       T00758                                 

Definition
(GenBank) hypothetical protein
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gly-zipper_YMGG Gly-zipper_Omp Gly-zipper_OmpA Rick_17kDa_Anti
Motif
Other DBs
NCBI-ProteinID: ACH84871
UniProt: B5EQH4
Position
complement(2660704..2660982)
Genome map
AA seq 92 aa AA seqDB search
MISGNFVSAVADRRRWLSPLALAFCVVALGGCANMSPTGQRALSGGAIGAAGGAVLGTVA
AGNPAVGAAVGGAVGAGVGAALPSIERTLNGN
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgatatcaggaaacttcgtaagcgctgttgcagaccggcggcgctggttgtctcctctc
gcgttggctttttgcgttgtggcgctcggcggctgtgccaatatgagccctactggtcag
cgtgccctgagcggcggcgccattggcgcggccggtggtgcggttctgggtactgtcgcc
gcaggcaatcccgctgtaggggctgcggtcggcggtgcggttggtgccggtgtaggcgcg
gcactccccagtatcgagcgcactctgaacggcaactga

DBGET integrated database retrieval system