KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2687Help
Entry
Lferr_2687        CDS       T00758                                 

Definition
(GenBank) ATPase, P-type (transporting), HAD superfamily, subfamily IC
  KO
K01535  H+-transporting ATPase [EC:3.6.3.6]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:afe00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Lferr_2687
Enzymes [BR:afe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.6  H+-exporting ATPase
     Lferr_2687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1-E2_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 HAD
Motif
Other DBs
NCBI-ProteinID: ACH84880
UniProt: B5EQI3
Position
complement(2672743..2675034)
Genome map
AA seq 763 aa AA seqDB search
MPENTCSGLSSDEARQRLAQYGPNAVIEEKPKNWLLFLHKFWAPVPWMLEGTLILEAILG
RWPEAIIITLLLIFNGVLGFSQERKAQSALELLKERLRIQARACRDGQWQSIPAADLVPG
DLVHVRVGDMVPADLHLSDGGILVDQSALTGESMPVERAAGDSLYSASVVRRGEASGEVT
ATGAKSYFGKTAELVRGAGAKSHLEELVLSIVRYLVMMDVILVAAILIYAAASHVPLAEI
LPFALILLVASVPVALPATFTLATAISSLHLVHRGVLVTRLAAVEEAAAMSDLCSDKTGT
LTQNRLSLSQAKGWPGVEETELLKMAAIASDSATQDPIDLAVLRASVAQTPHLPDRQQFV
PFDPATKRSEGVFMQDGASWRALKGSPQIIAKLCGNTDWEQATTDLAAGGARVLAVAAGP
DGQPRFFGLLALADPIRPDAAQVVQQLQELGVQVRMVTGDSPQTAKNVATALGIMGSVCD
GKALAEDCGVYAGVFPADKFHLVQGLQKKGRIVGMTGDGVNDAPALKQAEMGVAVESATD
VAKAAASLVLTAPGLQGVLDAVVTGRRVYQRMLTYTLNKIVKVFQVALFLSLGFLLFRSF
VVTPLLVLLLLFANDFVTMSLAEDNVRPSPKPDRWDIHTLVFSSLVVAFAWLIYIFAVYG
VGRSLGLPLASVQTLDFLGLVFSGLANVFLVRERGHLWASVPGRFLLWASLADILVVGGL
AAMGWLMAPLPMPIIVGLLLATMVYTLILDQIKVPLLRRLTSA
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgccggaaaacacctgtagcggactgagcagtgatgaagcgcggcaacggcttgcccaa
tatggccccaatgcagtcatcgaagaaaaacccaaaaactggctgctctttctccacaag
ttctgggcaccagtaccctggatgctggaaggcaccctgattctggaggccatattgggt
aggtggccggaagcgatcatcatcactttgctcctcatttttaatggagtgctcggcttc
agccaggagcgcaaggcgcagagcgcactggaactgctgaaagagcgactgcggattcag
gcccgcgcctgtcgcgatggacaatggcaaagtatcccggccgccgaccttgtgccgggc
gacctggttcatgtgcgggtcggggatatggttcccgccgatctgcatctcagcgatggt
ggcatattggtggaccaatccgcactgacgggcgagtccatgcccgtggagcgggcagcg
ggcgacagcctctattccgcctcggtcgtccgccgcggcgaagcttccggggaagttacg
gccacgggagccaaaagctattttggcaagaccgctgaactggtgcgcggcgccggtgcc
aaaagtcacctggaagaactggtgctctccatcgtccgttatctggtaatgatggacgtc
attctcgtcgccgcgatcctgatttacgcagccgccagccacgtcccccttgcggaaata
ttgccttttgcgctcatcctgttggttgcttcggtaccggtggcgctgcccgccactttc
accctggctacggccatctcctccctgcatctggtgcaccggggtgtgctggtcactcgc
ctggccgccgtggaggaagccgctgccatgagcgacctctgtagtgacaaaaccggcact
ctcactcagaaccgcctcagcctcagtcaggcaaagggttggcccggcgtggaagagacg
gagcttctgaagatggcggccatcgccagtgacagtgccactcaggatcccattgatctc
gccgttctccgtgcatcggtagcccagaccccacacctcccggaccgtcagcagttcgtg
ccttttgatcccgccaccaagcgttcggagggggttttcatgcaggacggcgcatcctgg
cgcgcactcaaaggctcaccccagatcatcgccaaactctgcggcaatacggactgggaa
caggcgacaacggatctcgccgccggtggcgcaagggtgctcgccgtggcagcgggcccg
gatggccaaccacgatttttcggtctgcttgcgctcgctgacccgatccgcccggatgcg
gcccaagtcgttcaacaattacaggaactgggcgtgcaggtgcgcatggtcaccggtgac
agtccgcagaccgcaaaaaatgttgccacagcgctgggtatcatgggcagcgtttgtgac
ggcaaggccctggctgaggactgtggtgtgtatgccggagtcttccccgctgataagttt
catctggtgcaagggttgcagaaaaaaggtcggatcgtcggaatgacgggcgacggggtc
aacgacgcccccgccctcaaacaggcagagatgggcgtggccgtggaaagcgccaccgat
gttgccaaggcggcggccagcctcgtgctcaccgcgcccggtttgcagggggtgcttgat
gcggtggtcaccgggcggcgcgtctatcagcgcatgctcacctacaccctcaataaaatt
gtcaaagtctttcaggtcgccctgttcctgagcctgggcttcctgctgttccgcagcttt
gtggttaccccgctgctggttcttctgctgctctttgccaacgatttcgtgaccatgtcc
ctggcggaggacaacgtgcgtccctcgccgaaaccggatcgctgggacatacataccctg
gtattttcctcgctggtcgttgccttcgcctggctgatttatatcttcgccgtgtatggt
gtgggccggtcgctggggctgccgctggcatccgtgcagaccctggatttccttggactg
gtattttccggcctggccaatgtttttttggtgcgggagcgtggccatctctgggcgtca
gtccccggtcgcttcctgctctgggccagcctcgcggatattctggtggtgggcggtctg
gctgcgatgggttggttgatggcgcccttaccgatgccgattatcgtcggcctgctcctg
gcgacgatggtctacaccctgatcctcgaccagatcaaggtgcctttgttgcggcgacta
accagtgcctga

DBGET integrated database retrieval system