KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2708Help
Entry
Lferr_2708        CDS       T00758                                 

Definition
(GenBank) Cytochrome b/b6 domain
  KO
K00412  ubiquinol-cytochrome c reductase cytochrome b subunit
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe00190  Oxidative phosphorylation
afe01100  Metabolic pathways
afe02020  Two-component system
Module
afe_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:afe00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Lferr_2708
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Lferr_2708
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:afe03029]
    Lferr_2708
Mitochondrial biogenesis [BR:afe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex III
    Lferr_2708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrome_B Cytochrom_B_N_2 Cytochrom_B_C
Motif
Other DBs
NCBI-ProteinID: ACH84900
UniProt: B5EQK3
Position
2694753..2695961
Genome map
AA seq 402 aa AA seqDB search
MSRFSAWVNKRLPVDETIREHMTEYFAPRNFNILYYAGSLLLLMIVLQLISGFFLMAHYV
PTSQDAFASVQGIMYDTKWGWLIRYMHVDGVSLIFILLYTHMFRGLLYGSHRAPRELVWV
IGYVIYLLMMAEAFVGYVLPFGNLSYWAGEVITSIMHALPVVGPSLTTLTRGGPGIGSAT
LQRFLALHVVLFFLIILAAIALHIVALHRVGSNNPDGIDIKKHKGPDGKPLDGVPFHPYY
TVKDLFGVGVWLTIFVSVIFYAPTMHGVFMERTTFLAANPMVSLPDVTPPWYLSPYYAML
RAVPNKYYGIAIMITSVLLPLLLPWLDRNPVRSSRYRPVYRIMLIVAGVSFIILAWIGQE
PPLPKYFLIERVATALYLGFYLLLPFVSMIEPTRPVPERVTG
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagtagattttcggcatgggttaacaagaggctcccggtagatgagaccataagggag
cacatgacagaatattttgcgccaagaaacttcaatattctatactatgcaggatcattg
ctgttgttgatgatcgtgctccagctgattagcgggttttttctgatggcgcattatgtt
cctacatctcaagatgcctttgcttcagtgcaaggcatcatgtacgacacaaaatggggc
tggttgatacgctatatgcatgttgatggcgtatctttaatatttatcttactctatacc
catatgtttcgcgggctactgtatggctcgcatcgtgcccctagggagcttgtttgggtt
atcgggtatgttatttatttgttaatgatggcggaagcctttgtcggctatgtattgcca
tttggaaatttatcttattgggctggcgaggttattacctccatcatgcacgcactgccg
gtggttgggccatctcttactaccctgacgcgcggcgggcccgggattgggtctgcgaca
ctgcaacgctttctagcgctgcacgtggttctgttcttccttattattctcgcagccatc
gcgctccatatcgtagcattgcatcgggtaggttcgaacaaccccgacggtattgacatc
aaaaaacacaagggcccggatggaaaaccgttagatggtgtaccatttcacccatattat
accgtgaaagacctgtttggtgttggggtttggctgaccatatttgtttctgttatattt
tatgctccaaccatgcatggggtattcatggaacgtacgacgttccttgccgcaaacccg
atggtcagtttaccagatgtaaccccaccttggtacctatcgccttattacgcaatgctc
cgtgcggtacctaacaagtattacggaatcgcaataatgattacatccgtcttgctgccg
ttgctgttgccttggctcgatcgtaacccggttcggtccagcagataccgtccagtgtac
aggataatgcttattgttgcgggggtttccttcattattttggcatggattggtcaggaa
ccaccgttgcctaaatatttcttgatcgagcgggtggcgacagctttatacctcgggttt
tacctcttgctgccgttcgttagcatgatagaacctacacggcccgtaccggagagggtt
acaggatga

DBGET integrated database retrieval system