KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2709Help
Entry
Lferr_2709        CDS       T00758                                 

Definition
(GenBank) cytochrome c1
  KO
K00413  ubiquinol-cytochrome c reductase cytochrome c1 subunit
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe00190  Oxidative phosphorylation
afe01100  Metabolic pathways
afe02020  Two-component system
Module
afe_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Lferr_2709
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Lferr_2709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C1 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: ACH84901
UniProt: B5EQK4
Position
2695958..2696686
Genome map
AA seq 242 aa AA seqDB search
MSTYRYLWFLLVSMLIPGIAWGAENTVHWMTPHYTFNRTTVIAGARYFADHCMACHSVSS
LRYEYLRADLGMTKKEVEKDIMLPNGAAWKGQIVSPMPPDMAAKWLGKPPPNLSHMDRYL
GSKFIYTYLLSFYWDPARPSGWNNYVFPMVAMPNILAPWGGTVGSKGQVIFPGRLSPAKY
HQNVADVVAFLRYASDPSYFTRMAIGPYVIGIMVLFTILAYFLKTAYWIDLKKKRSNTHT
KG
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgtacagatatctatggtttttgttggtgtccatgttgattcccgggatagca
tggggagcggaaaatacggtacactggatgacgccgcattatacgttcaaccggaccact
gtaatagctggagcgcgttattttgcagatcactgtatggcgtgtcattcagttagttcg
ttgcgttacgagtacctccgtgcagatcttggcatgacgaaaaaagaggtggagaaggac
atcatgcttccgaacggtgcggcctggaagggacaaatagtctccccaatgccccctgac
atggcagccaaatggttaggcaagcctcctccaaacttgagtcatatggaccggtatctt
ggctcaaaatttatttatacgtacctgctgtcattctattgggatcctgcgcgaccatca
ggttggaataattatgtgttcccaatggttgccatgccaaatatattggctccatggggc
ggtacggttgggtcaaaggggcaagtaatttttcccggaagactttctcctgccaagtat
caccaaaatgttgcagatgtcgtggcgttccttcggtacgcctcggatccttcgtatttt
acaagaatggctatcggcccatatgtcattggcataatggtactattcaccattcttgct
tattttctcaagacagcatattggattgatctgaagaaaaaacgtagtaatacccataca
aagggctag

DBGET integrated database retrieval system