KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2712Help
Entry
Lferr_2712        CDS       T00758                                 

Definition
(GenBank) hypothetical protein
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DrsE_2 DrsE
Motif
Other DBs
NCBI-ProteinID: ACH84904
UniProt: B5EQK7
Position
2700443..2700808
Genome map
AA seq 121 aa AA seqDB search
MRYLMIVVTTLDMEKSTAIEAVFNRAKAATAEYDVEVILTGESGVIATTHAVKSGIDEEY
LRLLYDSMRSAKSAGVKISICERSIEWCSLNNDELIPEIDDVVSSQYIMERAAPDTYVAY
F
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgagatatctgatgattgttgttacaaccctggatatggaaaagagcacagccatagag
gctgttttcaaccgggccaaagcagccacggctgagtacgatgtagaagttattttgact
ggagaatctggggttattgcaacaacacatgcggtaaaaagcggcatcgatgaagaatat
ctgcgtctactgtatgactctatgcgatctgcaaaatcagccggtgtgaaaattagtatt
tgcgaacgatctatagagtggtgcagtttaaataatgatgagcttatcccggagatagat
gacgtcgtcagcagtcaatatattatggagcgggccgcaccagatacatatgttgcttat
ttctga

DBGET integrated database retrieval system