KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2720Help
Entry
Lferr_2720        CDS       T00758                                 

Definition
(GenBank) flavodoxin/nitric oxide synthase
  KO
K00380  sulfite reductase (NADPH) flavoprotein alpha-component [EC:1.8.1.2]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe00920  Sulfur metabolism
afe01100  Metabolic pathways
afe01120  Microbial metabolism in diverse environments
Module
afe_M00176  Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Lferr_2720
Enzymes [BR:afe01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.2  assimilatory sulfite reductase (NADPH)
     Lferr_2720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1 SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: ACH84912
UniProt: B5EQW1
Position
2707224..2708990
Genome map
AA seq 588 aa AA seqDB search
MELIRQSDFLLDPRKQEDLRRFAEGMTREQLLWSSGYLTGFGESAPASKIQEDIGEKITI
LFGTETGNAKRLAELLAARAQAMGVQTSIQDMLTYGRAQLRRDRVIVLIVSTHGDGEPPD
SARMLLASLTDGPVPDLHGSRFAILALGDASYPKFCQAGKAFDIALASAGAERLLPRVDC
DVDYERDAMYWMEQVLGALTTGKSSPAVPFPAPVPKQGYSSHATFPAVLLGKVNLSGRGS
DREVWHLELDLDGSGLHYAPGDIVSVAPSNPPQLVEELLDRLELDHKASVRTRQGEMPLV
EALAAHYEITRITWPFLERYARLSDAKALQSAIAGRDVNGLDTWTDGREVIDIVGQYPVK
GLSAQSFADCLRPLPPRRYSIASSLLAVPGEVHLTVAAIRYSSHGRERLGVASTFLADRV
AIGRPVPIFIEPNAEFRLPEDSGQAMIMIGAGTGVAPFRSFLQEREALGAAGNNWLFFGD
RHFSTDFLYQREWLRWLRDGRLTRLDVAFSRDQERKIYVQDRLRERAGDVFAWLEEGAAV
YVCGAEAMGRAVHQSLVDIVQSAGRTQVQAEEYILELKQTGRYHRDVY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggaattgatccgacaatcagactttctactggacccgcgaaagcaggaggacctgcga
cgtttcgcggagggcatgactcgcgaacaattgctgtggtccagcggctatttgacgggt
tttggggaaagtgcgcctgcctcaaaaatacaagaagacattggagaaaagatcaccata
ctgtttggcacggaaaccggtaatgccaagcggttggcggaacttttggcggccagggcc
caggcgatgggtgtgcaaaccagcattcaggacatgttgacgtatggtcgtgcacaattg
cgccgggatcgcgtcatcgtgcttattgtcagtacgcatggggatggtgagccaccagac
agtgcccgcatgcttttggcttcactgaccgatgggccggttccggatctgcacggcagc
cgctttgccatattggcattgggtgatgccagttatccaaagttttgccaggcgggaaaa
gcgttcgatattgccctcgcttccgccggcgccgagcgccttctcccccgagtcgattgt
gacgtcgattacgaaagggatgccatgtattggatggagcaggtcctgggggcactcacc
accggcaagtcctctccggcagtaccgtttccggctcccgttccgaaacagggatactcg
agccatgccactttccccgccgttctgctgggcaaggtgaatctctccggccgcgggtcg
gacagggaagtctggcatctcgaactggacctcgacggatctggccttcactatgcacca
ggcgatatcgtgtccgttgctccgagcaatccgccccaactcgtagaggagctactcgac
cggctcgaactggaccacaaggcctccgtacggaccagacagggtgaaatgccgctggtg
gaggccctcgccgcgcactatgaaatcaccagaatcacatggccctttctggagcgttac
gcgcgcctgagtgacgcgaaggctttgcaaagcgcgattgccgggcgagatgtcaacggc
ctcgacacttggacagacggccgggaagtcatcgacatcgtcgggcaataccccgtcaag
gggcttagtgcgcaatccttcgccgactgcctgcggcccttgccgccgcggcggtattcc
atcgcctccagccttctcgccgttccgggcgaggtccacctgacggtcgccgccatccgc
tacagcagccacggacgggagcgtctgggggttgcctcgacatttctggcggatcgtgtc
gccatcggccggcctgtacccatatttatcgaacccaatgccgaattccggctacccgaa
gattccggacaggcgatgatcatgatcggggccggaaccggggtggccccctttcgttcc
ttcctgcaggaacgggaggcgctgggtgctgccggaaataactggcttttcttcggggac
cgtcacttcagcaccgattttctataccagcgggagtggctgcgctggctcagggatggg
cgcctcacccgactcgacgttgccttctcccgcgaccaggaacgcaagatatacgtccag
gaccgtttgcgggagcgtgccggtgacgtattcgcatggcttgaagaaggtgccgccgtg
tatgtttgcggggccgaagcgatgggcagggcggtacatcaatccctggtggatatcgtt
cagtcggccgggcgcacgcaggttcaggccgaggaatatattctggaattgaaacagacg
gggagatatcaccgagatgtctattaa

DBGET integrated database retrieval system