KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2736Help
Entry
Lferr_2736        CDS       T00758                                 

Definition
(GenBank) two component transcriptional regulator, Fis family
  KO
K15012  two-component system, response regulator RegA
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe02020  Two-component system
Module
afe_M00523  RegB-RegA (redox response) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:afe00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Lferr_2736
Two-component system [BR:afe02022]
 Other families
  RegB-RegA [MD:M00523]
   Lferr_2736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg HTH_8 HTH_30 OKR_DC_1_N HTH_28 HTH_1 Phage_NinH BrkDBD
Motif
Other DBs
NCBI-ProteinID: ACH84928
UniProt: B5EQX7
Position
2722793..2723368
Genome map
AA seq 191 aa AA seqDB search
MTVRTMENSADITATPVSNIMVVDDDVTFCRVLSNAFSRRGFEVCTVHDSADIIAVAELY
VPDAVVLDLRMPGVSGLEMISPLRSINQDIRILVLTGYASIATAIEAIKLGAVYYLTKPA
DADEIIARLHEKDGNPTAPVKNEFLSARRVEWEHINKVLMECNGNISAAARRLGMHRRSL
QRKMNKHPVRR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtaagaactatggaaaatagtgcggatatcaccgccacaccggtttctaacatt
atggtggtggacgacgatgtaaccttttgccgggtgctgtcaaacgcgttttccaggcgc
ggttttgaagtatgcactgtgcatgatagcgccgatataatcgcggttgcggaactttac
gtgccggacgccgtagttctggatctgcgaatgccgggggtttccggtttggaaatgata
agcccccttcggagcatcaaccaggatatcagaatccttgtgctcaccggttacgccagc
atcgcaacagcgattgaggccataaagctcggggcggtatattatctgacaaaacctgca
gatgcagatgagattatcgctaggttacatgaaaaggatggcaaccccaccgctccggtc
aaaaacgagttcttgtcagcgcgcagagttgaatgggagcatatcaacaaggtactgatg
gagtgtaatggcaacatatcggctgccgcccgcagactgggaatgcaccgacggtcctta
caacgcaagatgaataagcaccccgtacgacgctga

DBGET integrated database retrieval system