KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2739Help
Entry
Lferr_2739        CDS       T00758                                 

Definition
(GenBank) transcriptional regulator, BadM/Rrf2 family
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rrf2 HrcA_DNA-bdg Fe_dep_repress HTH_Crp_2 GntR
Motif
Other DBs
NCBI-ProteinID: ACH84931
UniProt: B5EQY0
Position
complement(2724827..2725267)
Genome map
AA seq 146 aa AA seqDB search
MMLSKASEYALRSLIYLAAQPSGRPVLSRDISDYIGGSAPCVTKVLRCLAKRGILYSVKG
KGGGYMLRPGAESLNIIDVIEITEGRPLEIRCILGHDCVRNTTLCPLHPQWEAIKSREMG
FLRGQTVGAISRAMFWVDAVTAAVQC
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgagcaaagctagcgaatatgccctgcggagtctaatttatctggccgctcag
ccatcgggaaggccggtgctgagccgggatatttctgactatatagggggctccgcgcca
tgcgttaccaaagtattgcgctgcttggccaagcgtggaatcctgtattccgtaaaaggg
aagggcggtggctatatgttgcgccctggtgccgagtccctaaatattattgacgtcatt
gagattaccgaagggcgtccgctagagatacgctgcatactgggccatgactgcgttaga
aatactacgctttgtcctctacatccacaatgggaggccatcaaaagccgtgaaatgggc
tttctaagggggcaaactgttggcgcgatatcgcgggcaatgttttgggttgatgcggtg
accgctgccgtgcagtgttag

DBGET integrated database retrieval system