KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2740Help
Entry
Lferr_2740        CDS       T00758                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr Folate_carrier
Motif
Other DBs
NCBI-ProteinID: ACH84932
UniProt: B5EQY1
Position
complement(2725282..2726475)
Genome map
AA seq 397 aa AA seqDB search
MSPFEKRAVAGLSFIYVARMLGLFMLMPVLALDNDQLRHSTPVLLGLAIGIYGLAQAALQ
FPFGVASDRFGRKRVLVFGLLIFVLGSLLGAVTHNIWGIILARLLQGAGAVSSVLLATAG
DLTGEQHRTKAMAAIGGSIAIAYVLGMAMGPVFYGLSGLTGVFLVAAALGVLALLPLWKV
IPPIPRNLQQRMGNWRDALRIFRYPPVLTASVGIFILQMVLGASFVVLSPELVKAMHIPG
SAVWEVYLPVMLLSVAGMLYPVIHAERHRQHGQMLVFSGLAIAAGALFMGLLAGHFWPVA
VGAVIFFTGYNVASAILPSMMSRSTTQEQRGAASGVYSLMQFLGIFAGGVVGGWGLGMAG
EQGVFYLLAVVGLLLALQSWNGKRVALLLEPDYSQKS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgttcgaaaagcgggcggtggcgggactgagcttcatctatgtcgcgcgcatg
ctcggtctgttcatgctcatgccggtactggccctggacaacgaccagcttcgccacagc
accccggtgctgttgggcctggccattggcatctacggactggcccaggccgccctgcag
tttcccttcggggtggcctccgaccgtttcgggcgcaagcgggtactggtctttggtctg
ctgatcttcgtcctgggttccctgctgggggcggtcacccacaacatctggggcatcatt
ctcgcccgtctgctgcagggtgcgggcgccgtctcctcggtgctcctggccaccgcaggg
gacctcaccggtgaacagcaccgcaccaaggccatggccgccatcggcggcagcatcgcc
atcgcctatgttctggggatggcgatggggcccgtcttttacggtctctccgggctgacc
ggggtatttctggtggccgccgcactcggcgtcctcgcgctgttaccgctgtggaaagtg
attccccccatcccccgcaatctgcagcagcgcatggggaactggcgtgacgccctgagg
atattcagataccccccggttctgaccgccagtgtcggcatcttcatcctgcagatggtg
ctgggggccagttttgtggtgctctccccggaactggtcaaggccatgcacattccgggc
agcgccgtctgggaagtgtatctgccggtgatgctgctctcggtggcgggcatgctctac
ccggtgatccacgccgaaaggcacagacagcacggacagatgctggtcttcagtggtctt
gccattgctgcgggagcgttgttcatgggtttgctcgctggtcacttctggccggtggcg
gtaggagcggtgattttcttcacgggttataacgtggcctcggcgattctgccttcgatg
atgagccgcagcaccacccaggaacagcggggggcggccagtggtgtatactcgctgatg
cagtttctggggatattcgcggggggtgtggtcggtggctgggggctgggcatggccggc
gagcagggtgtcttttatctccttgccgtcgtcggattgctcctcgccctgcaaagctgg
aacggaaaacgcgtggcactattgctggaaccggattattctcaaaaatcataa

DBGET integrated database retrieval system