KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2742Help
Entry
Lferr_2742        CDS       T00758                                 

Definition
(GenBank) hypothetical protein
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACH84934
UniProt: B5EQY3
Position
complement(2727455..2728408)
Genome map
AA seq 317 aa AA seqDB search
MRRNIHHGVSGGATYQDTNGIPHAVEGEMTPVVRVIGWLITGMLLAAVLTGLWRGMNSHQ
GFIADVVNGLKASEVGFAIALILLGSIVEGFGYGLSLGTRWPYTRNIAVLMVRGDPEAAH
RLVATLVGLVALALVILSPSITTISGLSLIVVTALFGMGTLYVLAGRAPAFVHGTHGLLA
YGVFLVYLTGLVYPELDFWSYLSAVGALHALLLAVFLGGMTTGQRGFGTAIGAFVKPQKA
SQWTIAAHVSAALLLVATLGWMMPAYPVAFYLAVTQVAVGFLLFHAVNLKPRDPGVMVVF
HQSMVLLMSLAIVLQWR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcaatattcatcatggggtatcgggcggggctacctaccaggatacgaacggc
attccccacgccgtagaaggggaaatgacgccggtagtacgagtgatcggctggctgatt
accgggatgctgctggcggcggtgctgaccgggttgtggcgtggcatgaacagccaccag
ggttttatagcggatgtcgtcaacggcctcaaagccagcgaagtaggttttgccattgcc
ctgatcctgctcggcagtattgttgagggtttcggctacggtctgtccttggggacccgc
tggccttacacgcgcaacatcgcggtactgatggtgcgtggtgatcctgaggctgcacat
cgcctggtagcgaccctggtcggcctggtggcccttgcgctggtgatactgtcgccaagt
atcactacgatcagcgggctgtccctgatcgtagttaccgccctgttcggtatgggcacc
ctgtatgtcctcgccggcagggccccggcgtttgttcacggcacccacggcctgctcgcc
tatggggtcttcctcgtttacctgaccggtctggtctatccggagctcgacttctggagc
tacctcagtgccgtaggtgctctgcatgccctgctcctcgccgtattcctcgggggcatg
accaccggtcagcgcggcttcggcactgccatcggcgccttcgtcaaacctcagaaggcc
tcacagtggaccatcgctgcccacgtcagtgcggccttgctgctggtcgccacccttggc
tggatgatgccagcttatcctgtcgctttttatctggcggtaacccaggttgctgttggt
tttttattgtttcatgcggtgaatctcaaaccccgggatcctggcgtcatggtggtcttt
caccaatccatggtcctgctcatgtccctcgccattgtcctgcagtggcgttaa

DBGET integrated database retrieval system