KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2743Help
Entry
Lferr_2743        CDS       T00758                                 

Definition
(GenBank) rusticyanin
  KO
K18683  rusticyanin
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Brite
KEGG Orthology (KO) [BR:afe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    Lferr_2743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SoxE Copper-bind Cu-oxidase_3 Cu-oxidase_2
Motif
Other DBs
NCBI-ProteinID: ACH84935
UniProt: B5EQY4
Structure
PDB: 

Position
complement(2728701..2729264)
Genome map
AA seq 187 aa AA seqDB search
MYTQNTMKKNWYVTVGAAAALAATVGMGTAMAGTLDTTWKEATLPQVKAMLEKDTGKVSG
DTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLEIPAGATVDVTFINTNKGFGHSFD
ITKKGPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTDFTWHPTAGTYYYVCQIPGHAATGM
FGKIVVK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtatacacagaacacgatgaaaaagaactggtatgtaactgttggtgcggctgcggct
ctggcggcaacggtcggcatgggcaccgcgatggccggtactctggataccacatggaaa
gaggcgacgcttccccaagtaaaggccatgttggagaaagacaccgggaaagtcagtggt
gacactgttacctacagtggcaagactgtacatgtggtcgcggcggccgtgctcccggga
tttccatttccgagttttgaagttcatgacaaaaagaacccgaccttggagattcccgcg
ggggcaacggtggacgtgaccttcattaacaccaacaagggattcggtcatagttttgac
atcaccaaaaaaggacctccttatgcggttatgccggtgatcgaccccattgttgcagga
acaggattcagtccggtcccaaaagatggcaagttcggatatacggattttacctggcat
ccgacggcgggcacttactactacgtatgtcagataccggggcatgccgccaccggtatg
ttcggtaagatcgttgtcaagtaa

DBGET integrated database retrieval system