KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2747Help
Entry
Lferr_2747        CDS       T00758                                 

Definition
(GenBank) Cytochrome-c oxidase
  KO
K02274  cytochrome c oxidase subunit I [EC:1.9.3.1]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe00190  Oxidative phosphorylation
afe01100  Metabolic pathways
Module
afe_M00155  Cytochrome c oxidase, prokaryotes
Brite
KEGG Orthology (KO) [BR:afe00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Lferr_2747
Enzymes [BR:afe01000]
 1. Oxidoreductases
  1.9  Acting on a heme group of donors
   1.9.3  With oxygen as acceptor
    1.9.3.1  cytochrome-c oxidase
     Lferr_2747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COX1
Motif
Other DBs
NCBI-ProteinID: ACH84939
UniProt: B5EQY8
Position
complement(2730441..2732324)
Genome map
AA seq 627 aa AA seqDB search
MATNEIQESALNNMGVDKTPFAASMLFPLVRATLWGLTGYFAAAWITALLLHTVIVNPLP
ATVGYVVGLVCWLMGSGVWEGWIRRAFGGKEAPTYTGIERYFRFGPDSKSTAVRYVVLNI
VTFFLAGMAAMAIRIELLTPDSTSWWLSEIQYNQTFGIHGLMMLLGVVASAIVGGVGYYL
IPLMLGTRNVVFPKLLGLSWWLLPPATVAVFMSPTIGGFQTGWWGYPPLAQNSGSGIVWY
VLGAATILFASLLGAINIAGTMVYMRAKGMSLGRVPIFVWGLFAAATILVVESPATYTGA
LMDLSDMIAGSHFYTGPTGHPLAYLDQFWFLFHPEVYVFILPAFAIWLEILPAAAKRPLF
ARGWAIAGLVGVSMLGAMLGVHHYFTAVSDARMPIFMTITETVSIPTGFIYLSAIGTLWG
GRLRINAAVLLVLMAMMNFLIGGLTGIFNADVPADLQLHNTYWVIAHFHYTMLGGVIFSW
IAALYWWFPKVTGRKINEFWGKFHAWWFFVFFNCTFFPMFIAGLDGMNRRIAIYLPYLHD
INLFMSISSFFLGAGFLIPLANLLYSWRYGPKAEANPWGSNGLEWQIKSPTPYVPYPAGT
EPEVVGPNDNYAAEAKEPFIWVPTPSK
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggcaactaacgaaattcaggaaagtgcgttgaacaacatgggagtggacaagacgcca
tttgcggccagcatgctgtttccgctggtccgtgcgacgctttggggactaaccggatat
tttgctgcggcatggattaccgctttattgctccatacggtaatagtaaatcctttaccc
gcgacagtgggttatgtggtcggcttggtctgctggctgatgggcagcggcgtatgggag
ggatggatacgacgcgcatttggaggaaaagaagccccaacttacacgggcatcgaacgt
tattttcgttttggtcccgattcaaaatctacggccgtacgctacgtggtattaaatata
gtaacattcttcctcgccggtatggccgccatggctatccgcattgaattgttgacgccg
gattccaccagttggtggctgtcggaaattcagtacaaccaaacgttcggtattcatgga
ttgatgatgttgctgggagtggtggcatctgccatcgtcggcggtgttggctactatctt
attccgttgatgcttggcacgagaaatgtagtattcccaaagcttctcggcctgagttgg
tggcttttaccaccggcgactgtcgctgttttcatgagtcctacgattggtgggtttcag
actggatggtggggatatccgccattggcgcaaaacagtggtagcggtattgtgtggtac
gtccttggtgccgccaccattctttttgcgtcgctacttggagccatcaatatcgccgga
accatggtgtacatgcgcgccaagggcatgagcttgggtcgcgttccgatttttgtgtgg
ggtttgtttgcggcagccactattctcgtcgtagagtcgccagcaacctataccggcgca
ctcatggatttgtccgatatgatcgccggatcacatttttacaccggccccaccgggcac
cccttagcgtatctggatcagttctggtttttgttccatccagaggtctacgttttcatc
ctgcccgcttttgccatatggctggagattcttcctgccgcggccaagcgtccgttattt
gctaggggttgggcaatcgctggactggttggcgtttccatgttgggtgcaatgttgggc
gttcatcactacttcactgcggtgagtgacgcacgtatgcccatattcatgacgataacg
gaaaccgtatccattccgacggggttcatttatttgtccgccatcgggacgttatggggt
ggtcgtttaagaattaacgctgcggtgttgctcgtgttgatggcgatgatgaacttcctg
atcggtggtctgacaggcatattcaatgccgatgttcccgcagaccttcagctgcacaac
acctactgggttattgcgcattttcattatacgatgcttggtggggtgatttttagctgg
attgccgcgctatactggtggtttcccaaggttactggacggaagatcaatgaattttgg
ggaaagtttcacgcatggtggtttttcgtattcttcaattgtacgttctttcccatgttt
atagctggcctcgatggaatgaacaggagaattgcgatatatcttccttacctgcatgac
attaacctgtttatgtctatctcgtcctttttcctgggcgcagggtttctcattccgctg
gccaaccttttatacagttggcgctatgggcccaaggccgaagccaacccttggggcagc
aacggcctggaatggcaaataaaatcgccaacaccgtatgtgccatatccggcagggact
gagccagaggttgtgggcccgaacgataactatgcggcggaagcgaaagaaccttttatt
tgggtacctacgccaagcaagtaa

DBGET integrated database retrieval system