KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2748Help
Entry
Lferr_2748        CDS       T00758                                 

Definition
(GenBank) cytochrome c oxidase subunit II
  KO
K02275  cytochrome c oxidase subunit II [EC:1.9.3.1]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
afe00190  Oxidative phosphorylation
afe01100  Metabolic pathways
Module
afe_M00155  Cytochrome c oxidase, prokaryotes
Brite
KEGG Orthology (KO) [BR:afe00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Lferr_2748
Enzymes [BR:afe01000]
 1. Oxidoreductases
  1.9  Acting on a heme group of donors
   1.9.3  With oxygen as acceptor
    1.9.3.1  cytochrome-c oxidase
     Lferr_2748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COX2 DUF2427 CPP1-like CcmH
Motif
Other DBs
NCBI-ProteinID: ACH84940
UniProt: B5EQY9
Position
complement(2732381..2733145)
Genome map
AA seq 254 aa AA seqDB search
MNAAKENLWKAFRGLVMVWIIGLAIGETLMAWGIGNWPILGSIQAHITADATTYLLWQAV
AIYVLVGGAVVYSAFRFRASSMSDTAAPAYQKRTWAPFVVTWLVLAIGINLANTIYPGMV
GLEQLWGIQLDTKNPLVIDVTAQQWKWTFSYPKQGVTDVSQLVVPEGRTIDFVLRTKDVM
HDFWVPAWGEKKDVIPNEVRHLFITPTMLGTTATNPMLRVQCSLICGNGHPLMRAPVKVV
TPADFKTWVANNSF
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcagcaaaagaaaatttatggaaagctttccgtggcttggtgatggtctggatt
attggcctggcgattggcgaaacgctgatggcctggggcatcggtaactggccaattttg
gggagtatccaggcgcatattaccgcggatgccaccacatacctgttatggcaggccgta
gccatatatgtgctggtcggcggtgcggttgtatatagcgcgtttcgtttccgcgcatcg
tccatgtcagacactgcggcgccggcttatcaaaagcggacctgggcacctttcgtagtg
acctggctggttttggccataggcatcaacctggcaaataccatttacccgggtatggtg
ggcctggaacaactttggggtatccagttagatacgaaaaatccattggtgatcgatgtt
accgcgcaacaatggaagtggacgttctcttatcccaagcagggcgtaacggatgtttca
caactggtggttccagaggggcgcaccatagactttgttctgcggacaaaggacgtcatg
cacgatttttgggtacctgcctggggtgagaaaaaggacgtgatcccaaatgaagtgcgg
cacttgtttattacacccaccatgctgggaacaaccgctacaaaccccatgctgcgtgta
cagtgttccttgatttgtggcaacggacatccgttgatgcgcgctccggttaaggtggtg
acaccagcggacttcaagacttgggtggcaaacaatagcttctag

DBGET integrated database retrieval system