KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2754Help
Entry
Lferr_2754        CDS       T00758                                 

Definition
(GenBank) Cytochrome c-like protein
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C CCP_MauG
Motif
Other DBs
NCBI-ProteinID: ACH84945
UniProt: B5EQZ4
Position
complement(2738646..2739548)
Genome map
AA seq 300 aa AA seqDB search
MCADSGPFWCGSAGTPDWQVSRALGLHAATPRQKSVGAESGSGPSVAGAGLSPPTRSGCP
GRDASIHKHTRRSCYVCLCHYQMPTSRQQRISSILSKVDGAFVFQILKHRLLLLRAFHTV
SSWLRASVDNEFPSNHGDGNYLTKARPVGCQLKKEILLMGYKIRFLISTLSASALLWCVT
ASAETSTNAMQNAIKNGSTLFASTSLGSRGNSCMTCHRGGGRSEGILPNGKSIPSLIGAA
ATFPHYNKRAGQVITLDMQVNSCIKNALLGKQLPYNSKKMVALVSYLTSLSQGKKINIIR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgctgattcgggaccattttggtgtggatctgcaggaacgcctgattggcaagtc
tctcgagcgttggggcttcacgccgcaacgccccgtcaaaagagcgttggagcagaatcc
ggaagcggtccgtcagtggctggagcaggactatccccgcctacgcgctcaggctgccca
ggaagggacgccagcatccataaacacacgcgcagatcctgttatgtatgcctatgccac
tatcagatgccgacttcacgtcaacaacgaatatcgtctatactctcaaaagttgacggc
gcgtttgttttccagatactgaagcatagacttttactactaagggccttccatactgtt
agctcctggcttcgagccagtgtagataacgagttcccgtcaaatcatggggacggtaac
tacctgacaaaagccagaccggttggttgccagttgaaaaaggagattttactcatggga
tataaaatacgttttctcataagcacgttgtcggcatctgccttgctctggtgtgtaacc
gcttctgcggaaacatcgacaaacgcaatgcaaaatgctatcaaaaacggctcgacactt
tttgcctcaacatccctggggagtcgcggtaattcctgcatgacctgtcatcgtggaggt
ggacgtagcgaaggaattttaccaaatggtaaatccatacccagcctcatcggtgctgcg
gccactttcccccactataacaaacgggctgggcaggtgattacccttgatatgcaagtt
aactcatgtatcaaaaacgctcttctgggtaaacagctgccttataacagcaagaaaatg
gtagcactcgttagctatttgacttccctttctcaaggcaagaaaattaacattatcaga
taa

DBGET integrated database retrieval system