KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2755Help
Entry
Lferr_2755        CDS       T00758                                 

Definition
(GenBank) heat shock protein Hsp90
  KO
K04079  molecular chaperone HtpG
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Brite
KEGG Orthology (KO) [BR:afe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:afe01009]
    Lferr_2755
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:afe03110]
    Lferr_2755
   04131 Membrane trafficking [BR:afe04131]
    Lferr_2755
   03051 Proteasome [BR:afe03051]
    Lferr_2755
   03029 Mitochondrial biogenesis [BR:afe03029]
    Lferr_2755
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:afe04147]
    Lferr_2755
Protein phosphatases and associated proteins [BR:afe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Lferr_2755
Chaperones and folding catalysts [BR:afe03110]
 Heat shock proteins
  HSP90
   Lferr_2755
Membrane trafficking [BR:afe04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    Lferr_2755
Ubiquitin system [BR:afe04121]
 Proteasome
  Assembling factors
   Other assembling factors
    Lferr_2755
Proteasome [BR:afe03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    Lferr_2755
Mitochondrial biogenesis [BR:afe03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    Lferr_2755
Exosome [BR:afe04147]
 Exosomal proteins
  Proteins found in most exosomes
   Lferr_2755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 TyeA
Motif
Other DBs
NCBI-ProteinID: ACH84946
UniProt: B5EQZ5
Position
complement(2739618..2741507)
Genome map
AA seq 629 aa AA seqDB search
MAASKETMQFQTEINQLLQLMIHSLYSNKEIFLRELISNASDACDKLRFEALADPALLTG
DSELKVEVDFDPEAGTITVRDNGIGMNRDEVIANIGTIAKSGTREFFERLSGDQTKDAKL
IGQFGVGFYSAFIVADRVSLNTRRAGMEAEHGVRWESDGTGTYTLETLDLPARGTEIVLH
LREEERQDLLSAWRLRSIINKYSDHIPLSIRMRKIGEGGKPGDEWETVNKASALWQRSKS
EISDDEYKEFYRYVSHDYGDPLTWSHNHVEGRLEYTSLLFIPAKAPFDLWDHNHPHGIKL
YVQRVFIMDDAEQLLPRYLRFVRGVIDSSDLPLNVSREILQGNRVIDQMRSGSVKRILGL
LEEMAEKEPEKYQTFWNEFGRVLKEGPGEDYSNREQIARLLRFASTHTDTDTQNVSLADY
LARMAEGQDKIYYITADSFLAAKNSPQLELLRKKGIEVLLLSDRVDEWLTSHLPEFEGKA
LTSVAKGALDLGAIETEEERKSQEETEKDAEGLVERIKNALGERVETVRVSHRLTSSPAC
IVLGERDMALYMQQLLKQAGHEISSTKPVLEINPTHPMLARIEGEKDDTRFAEWSALLLD
QAILAEGGQLEDPAGFVARINQLMLALAG
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggccgccagcaaggaaaccatgcaatttcaaaccgagatcaatcagctattgcagttg
atgatccattcgctttactccaacaaagagatcttcctgcgcgagttgatctccaatgcc
tccgacgcctgcgacaagctacgtttcgaggcattggccgaccctgccctcttgacaggt
gacagcgagctcaaggtagaggtggatttcgatcccgaggccggcaccattaccgtgcga
gacaacggtattggcatgaaccgcgacgaggtgatcgccaatatcggcactatcgccaaa
tccggaacgcgagaattctttgaacgcctcagcggcgatcagaccaaagacgccaagctg
atcggccagttcggagtaggtttttattcggcattcatcgttgcagatcgcgtcagcctg
aatactcgtcgcgccggcatggaggccgagcatggtgttcgctgggagtcggacggtacc
ggaacctacaccctggaaaccctggatctgcccgcgcgcggtaccgaaatcgtcttgcac
ctgcgcgaggaagaacgccaggacctgctcagcgcatggcgcttacgcagcatcatcaac
aagtattcggatcacatacccctgtcgatccgtatgcgcaaaataggcgaaggcggcaaa
cctggtgacgaatgggaaacggtcaataaggcctccgctctctggcaacgatccaagtcc
gagatcagcgacgacgagtacaaggagttttatcgctatgtcagccacgactatggtgac
cctctgacctggagccacaaccatgttgaaggacgactggaatacacctccttactcttc
attcctgccaaagcaccctttgatctctgggatcacaaccatccccacggtatcaagctc
tatgtgcagcgcgtcttcatcatggacgatgccgagcagctccttccccgctatctgcgc
tttgtgcgcggtgtgatcgattccagcgatttgcctcttaacgtctcccgcgagattctg
caaggtaaccgagtcattgatcagatgcgctccggttcggtgaaacgaatactgggtctc
ctcgaggaaatggccgagaaagagccagaaaaatatcagacgttttggaatgagttcgga
cgggtactcaaggaaggaccgggcgaggattacagcaaccgcgaacagatcgccaggctg
ctacgcttcgccagcacccacacggatacggacacgcaaaatgtatcgctggccgattac
ctcgcgcgtatggccgagggtcaagataaaatctactacatcactgcggactccttcctt
gccgccaagaacagcccacagttggagttgctgcgcaaaaaaggcatcgaagtattgctg
ctcagtgatcgcgtcgatgaatggctgaccagccatctgcccgaatttgagggtaaggca
ctgacatccgtcgccaagggtgcacttgacctgggcgccatcgaaaccgaagaagaacgc
aaatcgcaggaagaaaccgaaaaggatgctgagggtttggtggaacgcatcaaaaacgcc
ttaggcgagcgggtggagacggtgcgcgtatcccatcgtctgaccagttctccggcctgt
atcgtcctgggtgagcgggacatggccctgtacatgcagcaattgctcaagcaggccggc
cacgaaatatccagcaccaaacctgtcctggagatcaaccccacccatcccatgctggca
cgcatagaaggcgaaaaagacgatacccgcttcgccgaatggtcagcactgctgctggat
caagcgattctggccgagggggggcaattagaagatcccgccggcttcgtcgcccgcatc
aatcagttgatgcttgcgctggcaggctga

DBGET integrated database retrieval system